|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 3) Biological Unit 1 (2, 6) |
Asymmetric Unit (3, 3)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1RZL) |
Asymmetric Unit (1, 1)
|
(no "Exon" information available for 1RZL) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:91 aligned with NLTP1_ORYSI | A2ZHF1 from UniProtKB/Swiss-Prot Length:116 Alignment length:91 35 45 55 65 75 85 95 105 115 NLTP1_ORYSI 26 ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 116 SCOP domains d1rzla_ A: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) SCOP domains CATH domains 1rzlA00 A:1-91 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains Tryp_alpha_amyl-1rzlA01 A:1-87 ---- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------PLANT_LTP PDB: A:69-9- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 1rzl A 1 ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 91 10 20 30 40 50 60 70 80 90 Chain A from PDB Type:PROTEIN Length:91 aligned with NLTP1_ORYSJ | Q0IQK9 from UniProtKB/Swiss-Prot Length:116 Alignment length:91 35 45 55 65 75 85 95 105 115 NLTP1_ORYSJ 26 ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 116 SCOP domains d1rzla_ A: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) SCOP domains CATH domains 1rzlA00 A:1-91 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains Tryp_alpha_amyl-1rzlA01 A:1-87 ---- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) --------------------------------------------------------------------PLANT_LTP PDB: A:69-9- PROSITE (2) Transcript ------------------------------------------------------------------------------------------- Transcript 1rzl A 1 ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 91 10 20 30 40 50 60 70 80 90
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (NLTP1_ORYSI | A2ZHF1)
Chain A (NLTP1_ORYSJ | Q0IQK9)
|
|
|
|
|
|
|