2K9U - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION NMR STRUCTURE OF THE FILAMIN-MIGFILIN COMPLEX

Authors :   S. N. Ithychanda, J. Qin

Date :   24 Oct 08 (Deposition) - 23 Dec 08 (Release) - 03 Sep 14 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)
NMR Structure *: A,B  (1x)

Keywords :   Cytoskeletal Complex, Cell Adhesion, Cell Junction, Cell Shape, Cytoskeleton, Lim Domain, Metal-Binding, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. S. Ithychanda, M. Das, Y. Q. Ma, K. Ding, X. Wang, S. Gupta, C. Wu, E. F. Plow, J. Qin
Migfilin, A Molecular Switch In Regulation Of Integrin Activation.
J. Biol. Chem. V. 284 4713 2009
PubMed-ID: 19074766 | Reference-DOI: 10.1074/JBC.M807719200

Molecule 1 - GAMMA FILAMIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX5X-1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 919-1032
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FILAMIN-C, FILAMIN-2, PROTEIN FLNC, ACTIN-BINDING-LIKE PROTEIN, ABP-L, ABP-280-LIKE PROTEIN

Molecule 2 - FILAMIN-BINDING LIM PROTEIN 1
	Chains	:	B
	Engineered	:	YES
	Fragment	:	UNP RESIDUES 1-24
	Other Details	:	SYNTHETIC PEPTIDE OF THE SEQUENCE CORRESPONDING TO RESIDUES 1-24 OF HUMAN FILAMIN-BINDING LIM PROTEIN 1, UNIPROT ENTRY Q8WUP2, FBLI1_HUMAN
	Synonym	:	FBLP-1, MITOGEN-INDUCIBLE 2-INTERACTING PROTEIN, MIG2- INTERACTING PROTEIN, MIGFILIN
	Synthetic	:	YES

		1	2
NMR Structure (20x)	:	A	B
NMR Structure * (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2K9U)

(no "Site" information available for 2K9U)

(no "SS Bond" information available for 2K9U)

NMR Structure

No.	Model	Residues
1	1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20	Ser A:99	-	Pro A:100

(no "SAP(SNP)/Variant" information available for 2K9U)

NMR Structure (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FILAMIN_REPEAT	PS50194	Filamin/ABP280 repeat profile.	FLNC_HUMAN	270-368 370-468 469-565 566-658 662-758 759-861 862-960 961-1056 1057-1149 1150-1244 1245-1344 1345-1437 1438-1533 1534-1630 1643-1734 1785-1854 1854-1946 1944-2033 2036-2128 2221-2306 2309-2401 2403-2496 2500-2592 2630-2724	2	- - - - - - - - - - - - - - - - - - - - A:13-105 A:107-119 - -

NMR Structure * (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FILAMIN_REPEAT	PS50194	Filamin/ABP280 repeat profile.	FLNC_HUMAN	270-368 370-468 469-565 566-658 662-758 759-861 862-960 961-1056 1057-1149 1150-1244 1245-1344 1345-1437 1438-1533 1534-1630 1643-1734 1785-1854 1854-1946 1944-2033 2036-2128 2221-2306 2309-2401 2403-2496 2500-2592 2630-2724	2	- - - - - - - - - - - - - - - - - - - - A:13-105 A:107-119 - -

(no "Exon" information available for 2K9U)

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:119
 aligned with FLNC_HUMAN | Q14315 from UniProtKB/Swiss-Prot  Length:2725

    Alignment length:132
                                  2293      2303      2313      2323      2333      2343      2353      2363      2373      2383      2393      2403      2413  
          FLNC_HUMAN   2284 GPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTS 2415
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2            k9 uA00 A:1-119 Immunoglobulins                                                                                         CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------Filamin-2k Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------Filamin-2k Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------Filamin-2k Pfam domains (3)
         Sec.struct. author .------------..-..................eee......ee...eeeeeee......eeeeeeee.....eeeee.....eeeeeee....eeeeeeeee.........eeeeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE FILAMIN_REPEAT  PDB: - --FILAMIN_REPEAT  PDB: A:13-105 UniProt: 2309-2401                                             -FILAMIN_REPEA PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2k9u A    1 G------------IP-EFFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTS  119
                            |        -   || |  7        17        27        37        47        57        67        77        87        97       107       117  
                            1            2| 4                                                                                                                   
                                          3

Chain A from PDB  Type:PROTEIN  Length:119
 aligned with Q59H94_HUMAN | Q59H94 from UniProtKB/TrEMBL  Length:1342

    Alignment length:132
                                   910       920       930       940       950       960       970       980       990      1000      1010      1020      1030  
        Q59H94_HUMAN    901 GPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTS 1032
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2            k9 uA00 A:1-119 Immunoglobulins                                                                                         CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------Filamin-2k Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------Filamin-2k Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------Filamin-2k Pfam domains (3)
         Sec.struct. author .------------..-..................eee......ee...eeeeeee......eeeeeeee.....eeeee.....eeeeeee....eeeeeeeee.........eeeeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2k9u A    1 G------------IP-EFFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTS  119
                            |        -   || |  7        17        27        37        47        57        67        77        87        97       107       117  
                            1            2| 4                                                                                                                   
                                          3

Chain B from PDB  Type:PROTEIN  Length:24
 aligned with FBLI1_HUMAN | Q8WUP2 from UniProtKB/Swiss-Prot  Length:373

    Alignment length:24
                                    10        20    
         FBLI1_HUMAN      1 MASKPEKRVASSVFITLAPPRRDV   24
               SCOP domains ------------------------ SCOP domains
               CATH domains ------------------------ CATH domains
               Pfam domains ------------------------ Pfam domains
         Sec.struct. author .........eeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------ SAPs(SNPs)
                    PROSITE ------------------------ PROSITE
                 Transcript ------------------------ Transcript
                2k9u B    1 MASKPEKRVASSVFITLAPPRRDV   24
                                    10        20

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2K9U)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Homo sapiens. Organism_taxid: 9606. (14)

2k9uA00

A:1-119

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: E-set (290)

Family: Filamin (9)

Homo sapiens (Human) (7)

1a	Filamin-2k9uA01	A:110-119
1b	Filamin-2k9uA02	A:110-119
1c	Filamin-2k9uA03	A:110-119

NMR Structure(hide GO term definitions)

Chain A (Q59H94_HUMAN | Q59H94)

molecular function
	GO:0051015		actin filament binding		Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.

Chain A (FLNC_HUMAN | Q14315)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0030506	ankyrin binding	Interacting selectively and non-covalently with ankyrin, a 200 kDa cytoskeletal protein that attaches other cytoskeletal proteins to integral membrane proteins.
	GO:0008092	cytoskeletal protein binding	Interacting selectively and non-covalently with any protein component of any cytoskeleton (actin, microtubule, or intermediate filament cytoskeleton).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0034329	cell junction assembly	A cellular process that results in the aggregation, arrangement and bonding together of a set of components to form a cell junction.
	GO:0048747	muscle fiber development	The process whose specific outcome is the progression of the muscle fiber over time, from its formation to the mature structure. In skeletal muscle, fibers are formed by the maturation of myotubes. They can be classed as slow, intermediate/fast or fast.
cellular component
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0043034	costamere	Regular periodic sub membranous arrays of vinculin in skeletal and cardiac muscle cells, these arrays link Z-discs to the sarcolemma and are associated with links to extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0042383	sarcolemma	The outer membrane of a muscle cell, consisting of the plasma membrane, a covering basement membrane (about 100 nm thick and sometimes common to more than one fiber), and the associated loose network of collagen fibers.
	GO:0016528	sarcoplasm	The cytoplasm of a muscle cell; includes the sarcoplasmic reticulum.

Chain B (FBLI1_HUMAN | Q8WUP2)

molecular function
	GO:0031005	filamin binding	Interacting selectively and non-covalently with a filamin, any member of a family of high molecular mass cytoskeletal proteins that crosslink actin filaments to form networks and stress fibers. Filamins contain an amino-terminal alpha-actinin-like actin binding domain, which is followed by a rod-domain composed of 4 to 24 100-residue repetitive segments including a carboxy-terminal dimerization domain.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0034329	cell junction assembly	A cellular process that results in the aggregation, arrangement and bonding together of a set of components to form a cell junction.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0033623	regulation of integrin activation	Any process that modulates the frequency, rate, or extent of integrin activation.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
cellular component
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0001725	stress fiber	A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k9u)

	Sites
(no "Sites" information available for 2k9u)

	Cis Peptide Bonds
		Ser A:99 - Pro A:100	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2k9u
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FBLI1_HUMAN \| Q8WUP2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FLNC_HUMAN \| Q14315
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q59H94_HUMAN \| Q59H94
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FBLI1_HUMAN \| Q8WUP2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FLNC_HUMAN \| Q14315
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q59H94_HUMAN \| Q59H94
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	FBLI1_HUMAN \| Q8WUP2	:	2w0p 4p3w
	FLNC_HUMAN \| Q14315	:	1v05 2d7m 2d7n 2d7o 2d7p 2d7q 2nqc 3v8o 4mgx

(no "Related Entries Specified in the PDB File" available for 2K9U)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 20)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (1, 3)

Gene Ontology (27, 34)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File