Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF IG-LIKE DOMAIN 23 FROM HUMAN FILAMIN C
 
Authors :  L. Sjekloca, R. Pudas, B. Sjoeblom, P. Konarev, O. Carugo, V. Rybin, T. R D. Svergun, J. Ylanne, K. Djinovic-Carugo
Date :  31 Oct 06  (Deposition) - 11 Sep 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym./Biol. Unit :  A
Keywords :  Filamin, Immunoglobulin, Metal Binding, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Sjekloca, R. Pudas, B. Sjoeblom, P. Konarev, O. Carugo, V. Rybin, T. R. Kiema, D. Svergun, J. Ylanne, K. Djinovic-Carugo
Crystal Structure Of Human Filamin C Domain 23 And Small Angle Scattering Model For Filamin C 23-24 Dimer
J. Mol. Biol. V. 368 1011 2007
PubMed-ID: 17379241  |  Reference-DOI: 10.1016/J.JMB.2007.02.018

(-) Compounds

Molecule 1 - FILAMIN-C
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentIG-LIKE DOMAIN 23
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGAMMA-FILAMIN, FILAMIN-2, PROTEIN FLNC, ACTIN-BINDING- LIKE PROTEIN, ABP-L, ABP-280-LIKE PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2IMD2Ligand/IonIMIDAZOLE
3NI1Ligand/IonNICKEL (II) ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREIMD A:201 , IMD A:301 , CYS A:2532 , HIS A:2539BINDING SITE FOR RESIDUE NI A 101
2AC2SOFTWAREHOH A:18 , NI A:101 , IMD A:301 , LEU A:2518 , CYS A:2532 , HIS A:2539 , LEU A:2577BINDING SITE FOR RESIDUE IMD A 201
3AC3SOFTWARENI A:101 , IMD A:201 , CYS A:2532 , GLU A:2534 , HIS A:2539 , LEU A:2577 , SER A:2578BINDING SITE FOR RESIDUE IMD A 301
4AC4SOFTWAREVAL A:2528 , LEU A:2530 , PRO A:2548 , THR A:2573 , GLY A:2574BINDING SITE FOR RESIDUE GOL A 401
5AC5SOFTWAREHOH A:26 , HOH A:42 , ALA A:2490 , TYR A:2491 , SER A:2526 , LYS A:2527 , ARG A:2576BINDING SITE FOR RESIDUE GOL A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2NQC)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser A:2566 -Pro A:2567

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NQC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2NQC)

(-) Exons   (3, 3)

Asymmetric/Biological Unit (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003258881aENSE00001504141chr7:128470431-128471043613FLNC_HUMAN1-1181180--
1.2ENST000003258882ENSE00001691474chr7:128475380-128475628249FLNC_HUMAN118-201840--
1.3ENST000003258883ENSE00001267696chr7:128477214-12847731198FLNC_HUMAN201-233330--
1.4ENST000003258884ENSE00000882121chr7:128477452-128477602151FLNC_HUMAN234-284510--
1.5ENST000003258885ENSE00001207907chr7:128477691-128477809119FLNC_HUMAN284-323400--
1.6ENST000003258886ENSE00000882123chr7:128478041-12847811878FLNC_HUMAN324-349260--
1.7ENST000003258887ENSE00000882124chr7:128478321-128478483163FLNC_HUMAN350-404550--
1.8ENST000003258888ENSE00001207896chr7:128478657-128478857201FLNC_HUMAN404-471680--
1.9ENST000003258889ENSE00001372648chr7:128480077-128480214138FLNC_HUMAN471-517470--
1.10ENST0000032588810ENSE00001207885chr7:128480602-128480728127FLNC_HUMAN517-559430--
1.11ENST0000032588811ENSE00001207880chr7:128480888-128481024137FLNC_HUMAN559-605470--
1.12aENST0000032588812aENSE00001207874chr7:128481224-128481417194FLNC_HUMAN605-669650--
1.12cENST0000032588812cENSE00000882132chr7:128481508-128481621114FLNC_HUMAN670-707380--
1.13ENST0000032588813ENSE00000722075chr7:128482285-128482428144FLNC_HUMAN708-755480--
1.14ENST0000032588814ENSE00001665643chr7:128482629-128482752124FLNC_HUMAN756-797420--
1.15bENST0000032588815bENSE00001722751chr7:128482848-128483008161FLNC_HUMAN797-850540--
1.16ENST0000032588816ENSE00000882136chr7:128483283-12848337391FLNC_HUMAN851-881310--
1.17ENST0000032588817ENSE00001207844chr7:128483462-128483631170FLNC_HUMAN881-937570--
1.18ENST0000032588818ENSE00000364964chr7:128483850-128483967118FLNC_HUMAN938-977400--
1.19ENST0000032588819ENSE00001207833chr7:128484058-128484320263FLNC_HUMAN977-1064880--
1.20ENST0000032588820ENSE00000364966chr7:128484712-128485309598FLNC_HUMAN1065-12642000--
1.21ENST0000032588821ENSE00001207821chr7:128486044-128486217174FLNC_HUMAN1264-1322590--
1.22ENST0000032588822ENSE00001207814chr7:128486355-128486517163FLNC_HUMAN1322-1376550--
1.23ENST0000032588823ENSE00001207809chr7:128486799-128486959161FLNC_HUMAN1376-1430550--
1.24ENST0000032588824ENSE00001207805chr7:128487751-128487918168FLNC_HUMAN1430-1486570--
1.25ENST0000032588825ENSE00001207800chr7:128487999-128488122124FLNC_HUMAN1486-1527420--
1.26ENST0000032588826ENSE00001267489chr7:128488615-128488771157FLNC_HUMAN1527-1579530--
1.27ENST0000032588827ENSE00000882147chr7:128488847-128489036190FLNC_HUMAN1580-1643640--
1.28ENST0000032588828ENSE00001207789chr7:128489235-12848925824FLNC_HUMAN1643-165190--
1.29ENST0000032588829ENSE00001207785chr7:128489385-128489632248FLNC_HUMAN1651-1733830--
1.30ENST0000032588830ENSE00000721742chr7:128490030-12849012899FLNC_HUMAN1734-1766330--
1.31ENST0000032588831ENSE00000882153chr7:128490438-128490537100FLNC_HUMAN1767-1800340--
1.32ENST0000032588832ENSE00001504140chr7:128490857-128490997141FLNC_HUMAN1800-1847480--
1.33ENST0000032588833ENSE00001504139chr7:128491286-128491414129FLNC_HUMAN1847-1890440--
1.34ENST0000032588834ENSE00001131762chr7:128491509-128491682174FLNC_HUMAN1890-1948590--
1.35ENST0000032588835ENSE00001131757chr7:128492645-128492806162FLNC_HUMAN1948-2002550--
1.36ENST0000032588836ENSE00001131750chr7:128492882-128493085204FLNC_HUMAN2002-2070690--
1.37ENST0000032588837ENSE00001131743chr7:128493523-128493675153FLNC_HUMAN2070-2121520--
1.38ENST0000032588838ENSE00001131736chr7:128493769-128493891123FLNC_HUMAN2121-2162420--
1.39ENST0000032588839ENSE00001131730chr7:128494028-128494270243FLNC_HUMAN2162-2243820--
1.40ENST0000032588840ENSE00001131724chr7:128494467-128494736270FLNC_HUMAN2243-2333910--
1.41ENST0000032588841ENSE00001775548chr7:128494829-128494966138FLNC_HUMAN2333-2379470--
1.42ENST0000032588842ENSE00001775310chr7:128495253-128495368116FLNC_HUMAN2379-2417390--
1.43ENST0000032588843ENSE00000882170chr7:128496572-128496704133FLNC_HUMAN2418-2462450--
1.44ENST0000032588844ENSE00001131700chr7:128496799-128496975177FLNC_HUMAN2462-2521601A:2482-250120
1.45ENST0000032588845ENSE00001131697chr7:128497172-128497390219FLNC_HUMAN2521-2594741A:2501-257474
1.46ENST0000032588846ENSE00001764312chr7:128498062-128498271210FLNC_HUMAN2594-2664711A:2574-25785
1.47aENST0000032588847aENSE00001504137chr7:128498390-128499326937FLNC_HUMAN2664-2725620--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:97
 aligned with FLNC_HUMAN | Q14315 from UniProtKB/Swiss-Prot  Length:2725

    Alignment length:97
                                  2511      2521      2531      2541      2551      2561      2571      2581      2591       
          FLNC_HUMAN   2502 AGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLS 2598
               SCOP domains d2nqca_ A: automated matches                                                                      SCOP domains
               CATH domains 2nqcA00 A:2482-2578 Immunoglobulins                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhheeehhhh.eee....eeeeee........eeeeee.....eeeeeee..eeeeeee....eeeeeeeee..........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.44           ------------------------------------------------------------------------1.46  Transcript 1 (1)
           Transcript 1 (2) -------------------Exon 1.45  PDB: A:2501-2574 UniProt: 2521-2594                            ---- Transcript 1 (2)
                2nqc A 2482 AGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLS 2578
                                  2491      2501      2511      2521      2531      2541      2551      2561      2571       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2NQC)

(-) Gene Ontology  (17, 17)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (FLNC_HUMAN | Q14315)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0051015    actin filament binding    Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
    GO:0030506    ankyrin binding    Interacting selectively and non-covalently with ankyrin, a 200 kDa cytoskeletal protein that attaches other cytoskeletal proteins to integral membrane proteins.
    GO:0008092    cytoskeletal protein binding    Interacting selectively and non-covalently with any protein component of any cytoskeleton (actin, microtubule, or intermediate filament cytoskeleton).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0034329    cell junction assembly    A cellular process that results in the aggregation, arrangement and bonding together of a set of components to form a cell junction.
    GO:0048747    muscle fiber development    The process whose specific outcome is the progression of the muscle fiber over time, from its formation to the mature structure. In skeletal muscle, fibers are formed by the maturation of myotubes. They can be classed as slow, intermediate/fast or fast.
cellular component
    GO:0030018    Z disc    Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
    GO:0043034    costamere    Regular periodic sub membranous arrays of vinculin in skeletal and cardiac muscle cells, these arrays link Z-discs to the sarcolemma and are associated with links to extracellular matrix.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0042383    sarcolemma    The outer membrane of a muscle cell, consisting of the plasma membrane, a covering basement membrane (about 100 nm thick and sometimes common to more than one fiber), and the associated loose network of collagen fibers.
    GO:0016528    sarcoplasm    The cytoplasm of a muscle cell; includes the sarcoplasmic reticulum.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:2566 - Pro A:2567   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2nqc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FLNC_HUMAN | Q14315
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FLNC_HUMAN | Q14315
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FLNC_HUMAN | Q143151v05 2d7m 2d7n 2d7o 2d7p 2d7q 2k9u 3v8o 4mgx

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2NQC)