|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2J70) |
Sites (0, 0)| (no "Site" information available for 2J70) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2J70) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2J70) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2J70) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2J70) |
Exons (0, 0)| (no "Exon" information available for 2J70) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:83 aligned with RSBU_BACSU | P40399 from UniProtKB/Swiss-Prot Length:335 Alignment length:83 10 20 30 40 50 60 70 80 RSBU_BACSU 1 MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMA 83 SCOP domains d2j70a_ A: automated matches SCOP domains CATH domains 2j70A00 A:1-83 KaiA/RbsU domain CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2j70 A 1 MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMKGYGMA 83 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2J70) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (RSBU_BACSU | P40399)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|