|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (1, 4) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1W53) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1W53) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1W53) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1W53) |
Exons (0, 0)| (no "Exon" information available for 1W53) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:84 aligned with RSBU_BACSU | P40399 from UniProtKB/Swiss-Prot Length:335 Alignment length:84 10 20 30 40 50 60 70 80 RSBU_BACSU 1 MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAY 84 SCOP domains d1w53a_ A: Phosphoserine phosphatase RsbU, N-terminal domain SCOP domains CATH domains 1w53A00 A:1-84 KaiA/RbsU domain CATH domains Pfam domains -------RsbU_N-1w53A01 A:8-84 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 1w53 A 1 MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAY 84 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (RSBU_BACSU | P40399)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|