Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HIA 992-1098
 
Authors :  G. Meng, G. Waksman
Date :  23 Apr 06  (Deposition) - 23 May 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Keywords :  Trimeric Autotransporter, Adhesion, Membrane Protein, Protein Secretion, Microbial Pathogenesis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Meng, N. K. Surana, J. W. St Geme Iii, G. Waksman
Structure Of The Outer Membrane Translocator Domain Of The Haemophilus Influenzae Hia Trimeric Autotransporter.
Embo J. V. 25 2297 2006
PubMed-ID: 16688217  |  Reference-DOI: 10.1038/SJ.EMBOJ.7601132

(-) Compounds

Molecule 1 - ADHESIN
    Chains: A, B, C, D, E, F
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PASK-IBA12
    Expression System Strain: BL21(B834)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 1104-1204
    Organism Scientific: HAEMOPHILUS INFLUENZAE
    Organism Taxid: 727
    Strain: STRAIN 11

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): ABC   
Biological Unit 2 (1x):    DEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric Unit (1, 5)
No.NameCountTypeFull Name
1C8E5Ligand/Ion(HYDROXYETHYLOXY)TRI(ETHYLOXY)OCTANE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1C8E2Ligand/Ion(HYDROXYETHYLOXY)TRI(ETHYLOXY)OCTANE
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1C8E3Ligand/Ion(HYDROXYETHYLOXY)TRI(ETHYLOXY)OCTANE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH B:271 , ASN B:1059 , GLY B:1060 , LEU B:1061 , VAL D:1090 , ALA D:1092BINDING SITE FOR RESIDUE C8E B 1340
2AC2SOFTWAREHOH A:101 , VAL A:1048 , VAL C:1074 , VAL C:1094 , ARG F:1067 , SER F:1069 , ASN F:1071 , VAL F:1074 , ILE F:1076BINDING SITE FOR RESIDUE C8E A 1341
3AC3SOFTWAREVAL A:1094 , ARG D:1067 , SER D:1069 , ASN D:1071 , ILE D:1076BINDING SITE FOR RESIDUE C8E D 1342
4AC4SOFTWAREASP B:1070 , VAL B:1074 , TYR B:1096 , VAL C:1048 , C8E D:1344 , HOH E:45 , HOH E:152 , ARG E:1067 , SER E:1069 , ASN E:1071 , ILE E:1076BINDING SITE FOR RESIDUE C8E E 1343
5AC5SOFTWARETYR B:1096 , TRP B:1098 , TRP D:1098 , VAL E:1065 , ILE E:1076 , LEU E:1078 , C8E E:1343BINDING SITE FOR RESIDUE C8E D 1344

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GR7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GR7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GR7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GR7)

(-) Exons   (0, 0)

(no "Exon" information available for 2GR7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:101
 aligned with Q48152_HAEIF | Q48152 from UniProtKB/TrEMBL  Length:1098

    Alignment length:101
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 
        Q48152_HAEIF    998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
               SCOP domains d2gr7a1 A:998-1098 Adhesin Hia                                                                        SCOP domains
               CATH domains 2gr7A00 A:998-1098 GSPII I/J protein-like                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeeeee..eeeeeeeeeee.....eeeeeeeeee.....eeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                2gr7 A  998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 


Chain B from PDB  Type:PROTEIN  Length:101
 aligned with Q48152_HAEIF | Q48152 from UniProtKB/TrEMBL  Length:1098

    Alignment length:101
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 
        Q48152_HAEIF    998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
               SCOP domains d2gr7b_ B: Adhesin Hia                                                                                SCOP domains
               CATH domains 2gr7B00 B:998-1098 GSPII I/J protein-like                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeeeee..eeeeeeeeeee.....eeeeeeeeee.....eeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                2gr7 B  998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 


Chain C from PDB  Type:PROTEIN  Length:101
 aligned with Q48152_HAEIF | Q48152 from UniProtKB/TrEMBL  Length:1098

    Alignment length:101
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 
        Q48152_HAEIF    998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
               SCOP domains d2gr7c_ C: Adhesin Hia                                                                                SCOP domains
               CATH domains 2gr7C00 C:998-1098 GSPII I/J protein-like                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeeeee..eeeeeeeeeee.....eeeeeeeeee.....eeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                2gr7 C  998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 


Chain D from PDB  Type:PROTEIN  Length:101
 aligned with Q48152_HAEIF | Q48152 from UniProtKB/TrEMBL  Length:1098

    Alignment length:101
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 
        Q48152_HAEIF    998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
               SCOP domains d2gr7d_ D: Adhesin Hia                                                                                SCOP domains
               CATH domains 2gr7D00 D:998-1098 GSPII I/J protein-like                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeeeee..eeeeeeeeeee.....eeeeeeeeee.....eeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                2gr7 D  998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 


Chain E from PDB  Type:PROTEIN  Length:101
 aligned with Q48152_HAEIF | Q48152 from UniProtKB/TrEMBL  Length:1098

    Alignment length:101
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 
        Q48152_HAEIF    998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
               SCOP domains d2gr7e_ E: Adhesin Hia                                                                                SCOP domains
               CATH domains 2gr7E00 E:998-1098 GSPII I/J protein-like                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeeeee..eeeeeeeeeee.....eeeeeeeeee.....eeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                2gr7 E  998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 


Chain F from PDB  Type:PROTEIN  Length:101
 aligned with Q48152_HAEIF | Q48152 from UniProtKB/TrEMBL  Length:1098

    Alignment length:101
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097 
        Q48152_HAEIF    998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
               SCOP domains d2gr7f_ F: Adhesin Hia                                                                                SCOP domains
               CATH domains 2gr7F00 F:998-1098 GSPII I/J protein-like                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeeeee..eeeeeeeeeee.....eeeeeeeeee.....eeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                2gr7 F  998 AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW 1098
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GR7)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (Q48152_HAEIF | Q48152)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0019867    outer membrane    The external membrane of Gram-negative bacteria or certain organelles such as mitochondria and chloroplasts; freely permeable to most ions and metabolites.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    C8E  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gr7)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gr7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q48152_HAEIF | Q48152
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q48152_HAEIF | Q48152
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q48152_HAEIF | Q48152: 1s7m 2gr8 3emf 3emi 3emo

(-) Related Entries Specified in the PDB File

2gr8 HIA 1022-1098