|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2ENA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2ENA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2ENA) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2ENA) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZN224_HUMAN | Q9NZL3 from UniProtKB/Swiss-Prot Length:707 Alignment length:103 303 313 323 333 343 353 363 373 383 393 ZN224_HUMAN 294 GKSFCGRSRLNRHSMVHTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPYKCEECGKGFICRRDLYTHHMVHTGEKPYNCKECGKSFRWASCLLKHQRVHSG 396 SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ZINC_FINGER_C2H2_-------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 2ena A 1 GSS--GSS--------GTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKP-----------------------SG--PS----------------------SG 46 | | | - | 10 20 30 40 - - || ||- - - | 3 4 6 7 40 41| 43| 45 42 44
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2ENA) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2ENA) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2ENA) |
Gene Ontology (12, 12)|
NMR Structure(hide GO term definitions) Chain A (ZN224_HUMAN | Q9NZL3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|