|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (0, 0)| (no "Site" information available for 2EM6) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EM6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EM6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EM6) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2EM6) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZN224_HUMAN | Q9NZL3 from UniProtKB/Swiss-Prot Length:707 Alignment length:110 156 166 176 186 196 206 216 226 236 246 256 ZN224_HUMAN 147 SSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDECGKNFCYISALRIHQRVHMGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKPFKCVECGKGFSRRSALNVHHKLHTG 256 SCOP domains -----------------------------------------------------d2em6a1 A:9-35 ------------------------------ SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 2em6 A 1 GSSGS-------------------SG--------------------------MGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKP-------SGPS------------SG 46 | - - || - - - | 15 25 35 | - | | - 46 5 6| 8 40 41 44 45 7
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EM6) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EM6) |
Gene Ontology (12, 12)|
NMR Structure(hide GO term definitions) Chain A (ZN224_HUMAN | Q9NZL3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|