|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (0, 0)| (no "Site" information available for 2EOR) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EOR) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EOR) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EOR) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2EOR) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZN224_HUMAN | Q9NZL3 from UniProtKB/Swiss-Prot Length:707 Alignment length:60 249 259 269 279 289 299 ZN224_HUMAN 240 GFSRRSALNVHHKLHTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPFKCDICGKSFCG 299 SCOP domains ---------------d2eora1 A:8-35 ----------------- SCOP domains CATH domains ------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ZINC_FINGER_C2H-------ZINC_FINGER_C2H2_1 -------ZINC_FINGE PROSITE Transcript ------------------------------------------------------------ Transcript 2eor A 1 GSSGSSG--------TGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKP-----SGPS-SG 46 | - | 12 22 32 | - | | 46 7 8 40 41 44 | 45
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EOR) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EOR) |
Gene Ontology (12, 12)|
NMR Structure(hide GO term definitions) Chain A (ZN224_HUMAN | Q9NZL3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|