|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (0, 0)| (no "Site" information available for 2EMA) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EMA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EMA) |
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZN347_HUMAN | Q96SE7 from UniProtKB/Swiss-Prot Length:839 Alignment length:140 267 277 287 297 307 317 327 337 347 357 367 377 387 397 ZN347_HUMAN 258 GSPYKSNGCGMVFPQNSHLASHQRSHTKEKPYKCYECGKAFRTRSNLTTHQVIHTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPYKCNECGKVFTQNSHLVRHRGIHTGEKPYKCNECGKAFRARSSLAIHQATHSG 397 SCOP domains ------------------------------------------------------d2emaa1 A:8-35 ---------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------D------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -- PROSITE Transcript 1 Exon 1.5b PDB: A:1-46 (gaps) UniProt: 91-839 [INCOMPLETE] Transcript 1 2ema A 1 GS---SGSSG--------------------------------------------TGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKP-----------------------SG--P-------------S---------SG 46 | | 7 - - - - | 13 23 33 | - - -|| | - |- 46 2 3 7 8 40 41| 43 44 45 42
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EMA) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EMA) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (ZN347_HUMAN | Q96SE7)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|