|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (0, 0)| (no "Site" information available for 2EQ0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EQ0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EQ0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EQ0) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZN347_HUMAN | Q96SE7 from UniProtKB/Swiss-Prot Length:839 Alignment length:151 378 388 398 408 418 428 438 448 458 468 478 488 498 508 518 ZN347_HUMAN 369 GEKPYKCNECGKAFRARSSLAIHQATHSGEKPYKCNECGKVFTQNSHLTNHWRIHTGEKPYKCNECGKAFGVRSSLAIHLVIHTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKPYKCNECGKAFRAHSNLTTHQVIHTGEKPYKCNECG 519 SCOP domains -----------------------------------------------------------------------------------d2eq0a1 A:452-479 ---------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_ PROSITE Transcript 1 Exon 1.5b PDB: A:445-490 (gaps) UniProt: 91-839 [INCOMPLETE] Transcript 1 2eq0 A 445 GS-------------------------SGS-------------------------SG--------------------------TGEKPYKCHECGKVFRRNSHLARHQLIHTGEKP-----------------------SG--P----SSG 490 | - - 449 - - || - - - | 458 468 478 | - - 485| | 489 | 447 | 450| 452 484 485| | 488 446 449 451 486 | 487
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EQ0) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EQ0) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (ZN347_HUMAN | Q96SE7)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|