2DVV - JenaLib

Title :   CRYSTAL STRUCTURE OF THE SECOND BROMODOMAIN OF THE HUMAN BRD2 PROTEIN

Authors :   B. Padmanabhan, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   01 Aug 06 (Deposition) - 07 Aug 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A

Keywords :   Bromodomain, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. Padmanabhan, S. Yokoyama
Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (3, 3)

Asymmetric/Biological Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.7b	ENST00000399529	7b	ENSE00001705137	HSCHR6_MHC_QBL:32865184-32865580	397	BRD2_HUMAN	-	0	0	-	-
1.13b	ENST00000399529	13b	ENSE00002152230	HSCHR6_MHC_QBL:32868119-32869451	1333	BRD2_HUMAN	1-10	10	0	-	-
1.16e	ENST00000399529	16e	ENSE00001730437	HSCHR6_MHC_QBL:32870986-32871289	304	BRD2_HUMAN	10-111	102	0	-	-
1.17	ENST00000399529	17	ENSE00001742408	HSCHR6_MHC_QBL:32871904-32872041	138	BRD2_HUMAN	112-157	46	0	-	-
1.18a	ENST00000399529	18a	ENSE00001669691	HSCHR6_MHC_QBL:32872548-32872686	139	BRD2_HUMAN	158-204	47	0	-	-
1.19	ENST00000399529	19	ENSE00001606367	HSCHR6_MHC_QBL:32872768-32872982	215	BRD2_HUMAN	204-275	72	0	-	-
1.20b	ENST00000399529	20b	ENSE00002150037	HSCHR6_MHC_QBL:32873080-32873454	375	BRD2_HUMAN	276-400	125	1	A:1-400 (gaps)	97
1.20g	ENST00000399529	20g	ENSE00001741071	HSCHR6_MHC_QBL:32873960-32874088	129	BRD2_HUMAN	401-443	43	1	A:401-443	43
1.21b	ENST00000399529	21b	ENSE00001731564	HSCHR6_MHC_QBL:32874275-32874523	249	BRD2_HUMAN	444-526	83	1	A:444-455	12
1.22c	ENST00000399529	22c	ENSE00001594402	HSCHR6_MHC_QBL:32874644-32874906	263	BRD2_HUMAN	527-614	88	0	-	-
1.24c	ENST00000399529	24c	ENSE00001800691	HSCHR6_MHC_QBL:32876345-32876649	305	BRD2_HUMAN	614-716	103	0	-	-
1.24d	ENST00000399529	24d	ENSE00001781532	HSCHR6_MHC_QBL:32876859-32876981	123	BRD2_HUMAN	716-757	42	0	-	-
1.25d	ENST00000399529	25d	ENSE00001732199	HSCHR6_MHC_QBL:32877099-32878022	924	BRD2_HUMAN	757-801	45	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:112
 aligned with BRD2_HUMAN | P25440 from UniProtKB/Swiss-Prot  Length:801

    Alignment length:152
                                   313       323       333       343       353       363       373       383       393       403       413       423       433       443       453  
           BRD2_HUMAN   304 GSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD 455
               SCOP domains d                                2dv        va_ A: automated matches                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .--------------------------------.hh--------hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh..hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------BROMODOMAIN_2  PDB: A:364-436 UniProt: 364-436                           ------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------BROMODOMAIN_1  PDB: A:369-428 UniProt: 369-428              --------------------------- PROSITE (2)
               Transcript 1 Exon 1.20b  PDB: A:1-400 (gaps) UniProt: 276-400 [INCOMPLETE]                                    Exon 1.20g  PDB: A:401-443 UniProt: 401-443Exon 1.21b   Transcript 1
                 2dvv A   1 G--------------------------------SHM--------EQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD 455
                            |        -         -         -   | |   -    |  353       363       373       383       393       403       413       423       433       443       453  
                            |                                2 4      348                                                                                                           
                            1

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (BRD2_HUMAN | P25440)

molecular function
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0070577	lysine-acetylated histone binding	Interacting selectively and non-covalently with a histone in which a lysine residue has been modified by acetylation.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006334	nucleosome assembly	The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
	GO:0006357	regulation of transcription from RNA polymerase II promoter	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EPE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2dvv)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2dvv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BRD2_HUMAN \| P25440
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BRD2_HUMAN \| P25440
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description