|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (5, 7) Biological Unit 1 (2, 24) |
Asymmetric Unit (7, 7)
|
(no "SS Bond" information available for 2CC7) |
(no "Cis Peptide Bond" information available for 2CC7) |
(no "SAP(SNP)/Variant" information available for 2CC7) |
(no "PROSITE Motif" information available for 2CC7) |
(no "Exon" information available for 2CC7) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:64 aligned with DODEC_HALS3 | B0R5M0 from UniProtKB/Swiss-Prot Length:68 Alignment length:64 11 21 31 41 51 61 DODEC_HALS3 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 65 SCOP domains d2cc7a_ A: automated matches SCOP domains CATH domains 2cc7A00 A:2-65 Flavin-binding protein dodecin CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 2cc7 A 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 65 11 21 31 41 51 61 Chain A from PDB Type:PROTEIN Length:64 aligned with Q9HPW4_HALSA | Q9HPW4 from UniProtKB/TrEMBL Length:77 Alignment length:64 20 30 40 50 60 70 Q9HPW4_HALSA 11 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 74 SCOP domains d2cc7a_ A: automated matches SCOP domains CATH domains 2cc7A00 A:2-65 Flavin-binding protein dodecin CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 2cc7 A 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 65 11 21 31 41 51 61
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "Pfam Domain" information available for 2CC7) |
Asymmetric Unit(hide GO term definitions) Chain A (Q9HPW4_HALSA | Q9HPW4)
Chain A (DODEC_HALS3 | B0R5M0)
|
|
|
|
|
|
|