|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 9)| Asymmetric/Biological Unit (5, 9) |
Sites (9, 9)
Asymmetric Unit (9, 9)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2BML) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2BML) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BML) |
PROSITE Motifs (1, 10)
Asymmetric/Biological Unit (1, 10)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2BML) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:125 aligned with ALYS_STRPN | P06653 from UniProtKB/Swiss-Prot Length:318 Alignment length:125 203 213 223 233 243 253 263 273 283 293 303 313 ALYS_STRPN 194 YPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADKPEFTVEPDGLITVK 318 SCOP domains d2bmla_ A: automated matches SCOP domains CATH domains 2bmlA00 A:194-318 Cholin Binding CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE C-CW PDB: A:196-215 -CW PDB: A:217-237 CW PDB: A:238-257 CW PDB: A:258-277 --CW PDB: A:280-301 ----------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 2bml A 194 YPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADRPEFTVEPDGLITVK 318 203 213 223 233 243 253 263 273 283 293 303 313 Chain B from PDB Type:PROTEIN Length:126 aligned with ALYS_STRPN | P06653 from UniProtKB/Swiss-Prot Length:318 Alignment length:126 202 212 222 232 242 252 262 272 282 292 302 312 ALYS_STRPN 193 SYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADKPEFTVEPDGLITVK 318 SCOP domains d2bmlb_ B: automated matches SCOP domains CATH domains 2bmlB00 B:193-318 Cholin Binding CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE CW-CW PDB: B:196-215 -CW PDB: B:217-237 CW PDB: B:238-257 CW PDB: B:258-277 --CW PDB: B:280-301 ----------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 2bml B 193 SYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADRPEFTVEPDGLITVK 318 202 212 222 232 242 252 262 272 282 292 302 312
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BML) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (ALYS_STRPN | P06653)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|