|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 8)| Asymmetric/Biological Unit (3, 8) |
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1HCX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1HCX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1HCX) |
PROSITE Motifs (1, 10)
Asymmetric/Biological Unit (1, 10)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1HCX) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:127 aligned with ALYS_STRPN | P06653 from UniProtKB/Swiss-Prot Length:318 Alignment length:127 201 211 221 231 241 251 261 271 281 291 301 311 ALYS_STRPN 192 GSYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADKPEFTVEPDGLITVK 318 SCOP domains d1hcxa_ A: Choline binding domain of autolysin C-LytA SCOP domains CATH domains 1hcxA00 A:192-318 Cholin Binding CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CW -CW PDB: A:196-215 -CW PDB: A:217-237 CW PDB: A:238-257 CW PDB: A:258-277 --CW PDB: A:280-301 ----------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript 1hcx A 192 GSYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADRPEFTVEPDGLITVK 318 201 211 221 231 241 251 261 271 281 291 301 311 Chain B from PDB Type:PROTEIN Length:127 aligned with ALYS_STRPN | P06653 from UniProtKB/Swiss-Prot Length:318 Alignment length:127 201 211 221 231 241 251 261 271 281 291 301 311 ALYS_STRPN 192 GSYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADKPEFTVEPDGLITVK 318 SCOP domains d1hcxb_ B: Choline binding domain of autolysin C-LytA SCOP domains CATH domains 1hcxB00 B:192-318 Cholin Binding CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CW -CW PDB: B:196-215 -CW PDB: B:217-237 CW PDB: B:238-257 CW PDB: B:258-277 --CW PDB: B:280-301 ----------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript 1hcx B 192 GSYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADRPEFTVEPDGLITVK 318 201 211 221 231 241 251 261 271 281 291 301 311
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1HCX) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (ALYS_STRPN | P06653)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|