Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  COMPLEMENT RECEPTOR CHIMAERIC CONJUGATE CR2-IG
 
Authors :  H. E. Gilbert, M. Aslam, J. M. Guthridge, V. M. Holers, S. J. Perkins
Date :  26 Aug 05  (Deposition) - 31 Jan 06  (Release) - 21 Jun 17  (Revision)
Method :  SOLUTION SCATTERING
Resolution :  NOT APPLICABLE
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Immunoglobulin Fold, Antibody, Complement, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. E. Gilbert, M. Aslam, J. M. Guthridge, V. M. Holers, S. J. Perkins
Extended Flexible Linker Structures In The Complement Chimaeric Conjugate Cr2-Ig By Scattering, Analytical Ultracentrifugation And Constrained Modelling: Implications For Function And Therapy.
J. Mol. Biol. V. 356 397 2006
PubMed-ID: 16375923  |  Reference-DOI: 10.1016/J.JMB.2005.11.050

(-) Compounds

Molecule 1 - COMPLEMENT RECEPTOR CHIMERIC CONJUGATE CR2-IG
    Chains: A, B
    Engineered: YES
    Expression System: MUS MUSCULUS
    Expression System Cell Line: NS/0
    Expression System Common: MOUSE
    Expression System Taxid: 10090
    Gene: CR2, C3DR, IGHG1, IGH-4
    Organism Common: HUMAN, MOUSE
    Organism Scientific: HOMO SAPIENS, MUS MUSCULUS
    Organism Taxid: 9606, 10090
    Other Details: CHIMERIC PROTEIN CONSISTING OF PORTIONS OF A COMPLEMENT COMPONENT CR2 FROM HUMAN, A LINKER REGION, AND A PORTION OF IMMUNOGLOBULIN GAMMA CHAIN FROM MOUSE.

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ATY)

(-) Sites  (0, 0)

(no "Site" information available for 2ATY)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ATY)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ATY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric/Biological Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016164S639NCR2_HUMANPolymorphism17615A/BS344N
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 24)

Asymmetric/Biological Unit (1, 24)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SUSHIPS50923 Sushi/CCP/SCR domain profile.CR2_HUMAN21-84
 
89-148
 
152-212
 
213-273
 
274-344
 
408-468
 
349-407
 
469-524
 
525-595
 
600-659
 
660-716
 
717-781
 
786-845
849-909
910-970		  24A:2-65
B:2-65
A:70-129
B:70-129
A:133-164
B:133-164
A:168-191
B:168-191
A:196-223
B:196-223
A:270-282
B:270-282
A:228-260
B:228-260
A:283-296
B:283-296
A:298-316
B:298-316
A:317-351
B:317-351
A:354-356
B:354-356
A:358-375
B:358-375
-
-
-

(-) Exons   (0, 0)

(no "Exon" information available for 2ATY)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:376
 aligned with CR2_HUMAN | P20023 from UniProtKB/Swiss-Prot  Length:1033

    Alignment length:750
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769
            CR2_HUMAN    20 GISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANFFCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSIVTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGRMVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQKEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLTKPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAVQCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGH 769
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................................................................................................................................----...-......---..............-----------....-----..------..........-....--.......--------------........----------------------------------....---------....--..................---------........----------------------..................-.............-..........-----..............--------------------------------------------------..............----------------------------...-----------------.................-----------------------------------------------.........----....................---........--------------------------------------------------------------.......-----......-------------------------....---...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -SUSHI  PDB: A:2-65 UniProt: 21-84                               ----SUSHI  PDB: A:70-129 UniProt: 89-148                        ---SUSHI  PDB: A:133-164 UniProt: 152-212                       SUSHI  PDB: A:168-191 UniProt: 213-273                       SUSHI  PDB: A:196-223 UniProt: 274-344                                 ----SUSHI  PDB: A:228-260 UniProt: 349-407                     SUSHI  PDB: A:270-282 UniProt: 408-468                       SUSHI  PDB: A:283-296 UniProt: 469-524                  SUSHI  PDB: A:298-316 UniProt: 525-595                                 ----SUSHI  PDB: A:317-351 UniProt: 600-659                      SUSHI  PDB: A:354-356 UniProt: 660-716                   SUSHI  PDB: A:358-375 UniProt: 717-781                PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2aty A   1 DISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLEG----SIE-GRGGSE---LADPEVPRDCGCKP-----------CICT-----VP------EVSSVFIFPP-KPKD--VLTITLT--------------PKVTCVVV----------------------------------DISK---------DDPE--VQFSWFVDDVEVHTAQTQ---------PREEQFNS----------------------TFRSVSELPIMHQDWLNG-KEFKCRVNSAAFP-APIEKTISKT-----KGRPKAPQLYTIPP--------------------------------------------------PKEQMAKDKVSLTC----------------------------MIT-----------------DFFPEDITVEWQWNGQP-----------------------------------------------AENYKNTQP----IMNTNESYFVYSKLNVQKSN---WEAGNTFT--------------------------------------------------------------CSVLHEG-----LHNHHT-------------------------EKSL---SHSPGK 376
                                    10        20        30        40        50        60        70        80        90       100       110       120       130    |  136 | |    |-  |    152     |   -       161|     || -    |  170   | |  |- |     | -         -  |    193         -         -         -    |  | -       200|  |   208       218|        -|      | -         -         -|      237       246       256 | |   265  |    270       280 |       -         -         -         -         -  |    290     |   -         -         -    | |  -         -    |  305       315|        -         -         -         -       318      |  - |     334       344|   |  351 |       -         -         -         -         -         -    |  359|     |364 |       -         -       369|   |  376
                                                                                                                                                                135  136 | |  144 145          158         159  |   163|    165      174 |  |  |   185            186    193                                194  |       198  |  |              219       220    227                    228              245 |         258 |      268   269          282                                                283          296                          297 |               300             316                                             317     325  326                345 346    353                                                            354   360   361  366                       367  | 371     
                                                                                                                                                                       138 |                                  162    164               175  |  |                                                               197          201  |                                                                         246           259                                                                                                                        299                                                                                                                                                                                                                                       370         
                                                                                                                                                                         139                                                              178  |                                                                               202                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
                                                                                                                                                                                                                                             179                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          


Chain A from PDB  Type:PROTEIN  Length:376
 aligned with IGHG1_MOUSE | P01868 from UniProtKB/Swiss-Prot  Length:324

    Alignment length:376
                                                                                                    50                                                                                                                                                                                                                                                                                                              
                              1    6       7 9 10  14    15      23  24    30   31                49 |  54  55                 74                 75            89      90                                                                                                                                                                                                                                          
                              |    | -     | | -|   |    -|       |-  |     |-   |    37        47 | |   | - |      63        73|        -        75        85   |     - |      98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318      
          IGHG1_MOUSE     - --AKTTPP-------SVY--PLAPG-----SAAQTNSMV---TLGCLVK----GYFPEPVTVTWNSGSLSSG-VHTFP---AVLQSDLYTLSSSVTVPSSP------------------RPSETVTCNVAHPAS-------STKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 324
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................................................................................................................................................................................................................................................................................................................................................................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N-------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2aty A   1 DISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLEGSIEGRGGSELADPEVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQLYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNESYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 376
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370      


Chain B from PDB  Type:PROTEIN  Length:376
 aligned with CR2_HUMAN | P20023 from UniProtKB/Swiss-Prot  Length:1033

    Alignment length:750
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769
            CR2_HUMAN    20 GISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANFFCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSIVTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGRMVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQKEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLTKPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAVQCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGH 769
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................................................................................................................................----...-......---..............-----------....-----..------..........-....--.......--------------........----------------------------------....---------....--..................---------........----------------------..................-.............-..........-----..............--------------------------------------------------..............----------------------------...-----------------.................-----------------------------------------------.........----....................---........--------------------------------------------------------------.......-----......-------------------------....---...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -SUSHI  PDB: B:2-65 UniProt: 21-84                               ----SUSHI  PDB: B:70-129 UniProt: 89-148                        ---SUSHI  PDB: B:133-164 UniProt: 152-212                       SUSHI  PDB: B:168-191 UniProt: 213-273                       SUSHI  PDB: B:196-223 UniProt: 274-344                                 ----SUSHI  PDB: B:228-260 UniProt: 349-407                     SUSHI  PDB: B:270-282 UniProt: 408-468                       SUSHI  PDB: B:283-296 UniProt: 469-524                  SUSHI  PDB: B:298-316 UniProt: 525-595                                 ----SUSHI  PDB: B:317-351 UniProt: 600-659                      SUSHI  PDB: B:354-356 UniProt: 660-716                   SUSHI  PDB: B:358-375 UniProt: 717-781                PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2aty B   1 DISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLEG----SIE-GRGGSE---LADPEVPRDCGCKP-----------CICT-----VP------EVSSVFIFPP-KPKD--VLTITLT--------------PKVTCVVV----------------------------------DISK---------DDPE--VQFSWFVDDVEVHTAQTQ---------PREEQFNS----------------------TFRSVSELPIMHQDWLNG-KEFKCRVNSAAFP-APIEKTISKT-----KGRPKAPQLYTIPP--------------------------------------------------PKEQMAKDKVSLTC----------------------------MIT-----------------DFFPEDITVEWQWNGQP-----------------------------------------------AENYKNTQP----IMNTNESYFVYSKLNVQKSN---WEAGNTFT--------------------------------------------------------------CSVLHEG-----LHNHHT-------------------------EKSL---SHSPGK 376
                                    10        20        30        40        50        60        70        80        90       100       110       120       130    |  136 | |    |-  |    152     |   -       161|     || -    |  170   | |  |- |     | -         -  |    193         -         -         -    |  | -       200|  |   208       218|        -|      | -         -         -|      237       246       256 | |   265  |    270       280 |       -         -         -         -         -  |    290     |   -         -         -    | |  -         -    |  305       315|        -         -         -         -       318      |  - |     334       344|   |  351 |       -         -         -         -         -         -    |  359|     |364 |       -         -       369|   |  376
                                                                                                                                                                135  136 | |  144 145          158         159  |   163|    165      174 |  |  |   185            186    193                                194  |       198  |  |              219       220    227                    228              245 |         258 |      268   269          282                                                283          296                          297 |               300             316                                             317     325  326                345 346    353                                                            354   360   361  366                       367  | 371     
                                                                                                                                                                       138 |                                  162    164               175  |  |                                                               197          201  |                                                                         246           259                                                                                                                        299                                                                                                                                                                                                                                       370         
                                                                                                                                                                         139                                                              178  |                                                                               202                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
                                                                                                                                                                                                                                             179                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          


Chain B from PDB  Type:PROTEIN  Length:376
 aligned with IGHG1_MOUSE | P01868 from UniProtKB/Swiss-Prot  Length:324

    Alignment length:376
                                                                                                    50                                                                                                                                                                                                                                                                                                              
                              1    6       7 9 10  14    15      23  24    30   31                49 |  54  55                 74                 75            89      90                                                                                                                                                                                                                                          
                              |    | -     | | -|   |    -|       |-  |     |-   |    37        47 | |   | - |      63        73|        -        75        85   |     - |      98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318      
          IGHG1_MOUSE     - --AKTTPP-------SVY--PLAPG-----SAAQTNSMV---TLGCLVK----GYFPEPVTVTWNSGSLSSG-VHTFP---AVLQSDLYTLSSSVTVPSSP------------------RPSETVTCNVAHPAS-------STKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 324
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................................................................................................................................................................................................................................................................................................................................................................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N-------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2aty B   1 DISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLEGSIEGRGGSELADPEVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQLYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNESYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 376
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2ATY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2ATY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ATY)

(-) Gene Ontology  (37, 38)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (IGHG1_MOUSE | P01868)
molecular function
    GO:0003823    antigen binding    Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
biological process
    GO:0019731    antibacterial humoral response    An immune response against bacteria mediated through a body fluid. Examples of this process are the antibacterial humoral responses in Mus musculus and Drosophila melanogaster.
    GO:0001788    antibody-dependent cellular cytotoxicity    Cytolysis of target cells by natural killer cells, eosinophils, neutrophils, monocytes, or macrophages following engagement of antibodies bound to the target cells by Fc receptors on the effector cells.
    GO:0006958    complement activation, classical pathway    Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0002455    humoral immune response mediated by circulating immunoglobulin    An immune response dependent upon secreted immunoglobulin. An example of this process is found in Mus musculus.
    GO:0016064    immunoglobulin mediated immune response    An immune response mediated by immunoglobulins, whether cell-bound or in solution.
    GO:0006911    phagocytosis, engulfment    The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
    GO:0006910    phagocytosis, recognition    The initial step in phagocytosis involving adhesion to bacteria, immune complexes and other particulate matter, or an apoptotic cell and based on recognition of factors such as bacterial cell wall components, opsonins like complement and antibody or protein receptors and lipids like phosphatidyl serine, and leading to intracellular signaling in the phagocytosing cell.
    GO:0050778    positive regulation of immune response    Any process that activates or increases the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
    GO:0050766    positive regulation of phagocytosis    Any process that activates or increases the frequency, rate or extent of phagocytosis.
    GO:0001812    positive regulation of type I hypersensitivity    Any process that activates or increases the frequency, rate or extent of type I hypersensitivity, a type of inflammatory response.
    GO:0001798    positive regulation of type IIa hypersensitivity    Any process that activates or increases the frequency, rate or extent of type IIa hypersensitivity, a type of inflammatory response.
cellular component
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0042571    immunoglobulin complex, circulating    An immunoglobulin complex that is secreted into extracellular space and found in mucosal areas or other tissues or circulating in the blood or lymph. In its canonical form, a circulating immunoglobulin complex is composed of two identical heavy chains and two identical light chains, held together by disulfide bonds. Some forms of are polymers of the basic structure and contain additional components such as J-chain and the secretory component.

Chain A,B   (CR2_HUMAN | P20023)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0001848    complement binding    Interacting selectively and non-covalently with any component or product of the complement cascade.
    GO:0004875    complement receptor activity    Combining with any component or product of the complement cascade and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0030183    B cell differentiation    The process in which a precursor cell type acquires the specialized features of a B cell. A B cell is a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
    GO:0042100    B cell proliferation    The expansion of a B cell population by cell division. Follows B cell activation.
    GO:0006958    complement activation, classical pathway    Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
    GO:0002430    complement receptor mediated signaling pathway    A series of molecular signals generated as a consequence of a component of the complement pathway binding to a complement receptor. Such components include both whole complement proteins and fragments of complement proteins generated through the activity of the complement pathway.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2aty)
 
  Sites
(no "Sites" information available for 2aty)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2aty)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2aty
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CR2_HUMAN | P20023
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  IGHG1_MOUSE | P01868
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CR2_HUMAN | P20023
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IGHG1_MOUSE | P01868
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CR2_HUMAN | P20023: 1ghq 1ly2 1w2r 1w2s 2gsx 3oed
        IGHG1_MOUSE | P01868: 1ahw 1ai1 1bm3 1clo 1ct8 1dba 1dbb 1dbj 1dbk 1dbm 1emt 1fbi 1fdl 1fns 1gpo 1k4d 1kel 1kem 1mf2 1mlc 1n5y 1n6q 1ntl 1oak 1opg 1p2c 1p7k 1r0a 1r3i 1r3j 1r3k 1r3l 1rih 1seq 1t2q 1yed 2b2x 2dbl 3zo0

(-) Related Entries Specified in the PDB File

1ghq CR2-C3D COMPLEX STRUCTURE
1igy STRUCTURE OF INTACT ANTIBODY IGG1
1w2r SOLUTION STRUCTURE OF FREE CR2 SCR 1-2