|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XYY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XYY) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1XYY) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:147 aligned with FLAV_DESVH | P00323 from UniProtKB/Swiss-Prot Length:148 Alignment length:147 11 21 31 41 51 61 71 81 91 101 111 121 131 141 FLAV_DESVH 2 PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI 148 SCOP domains d1xyya_ A: Flavodoxin SCOP domains CATH domains 1xyyA00 A:2-148 [code=3.40.50.360, no name defined] CATH domains Pfam domains ----Flavodoxin_1-1xyyA01 A:6-140 -------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --FLAVODOXIN_LIKE PDB: A:4-145 UniProt: 4-145 --- PROSITE (1) PROSITE (2) ----FLAVODOXIN ------------------------------------------------------------------------------------------------------------------------------ PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1xyy A 2 AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI 148 11 21 31 41 51 61 71 81 91 101 111 121 131 141
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (FLAV_DESVH | P00323)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|