Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  LOW TEMPERATURE (100K) CRYSTAL STRUCTURE OF FLAVODOXIN MUTANT S64C, DIMER, SEMIQUINONE STATE
 
Authors :  R. Artali, N. Marchini, F. Meneghetti, D. Cavazzini, G. Bombieri, G. L. G. Gilardi
Date :  12 Nov 04  (Deposition) - 07 Dec 04  (Release) - 22 Dec 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.69
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Flavodoxin, S64C Mutant, Dimer, Semireduced Form, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Fantuzzi, R. Artali, G. Bombieri, N. Marchini, F. Meneghetti, G. Gilardi, S. J. Sadeghi, D. Cavazzini, G. L. Rossi
Redox Properties And Crystal Structures Of A Desulfovibrio Vulgaris Flavodoxin Mutant In The Monomeric And Homodimeric Forms.
Biochim. Biophys. Acta V. 1794 496 2009
PubMed-ID: 19118653  |  Reference-DOI: 10.1016/J.BBAPAP.2008.11.026

(-) Compounds

Molecule 1 - FLAVODOXIN
    ChainsA
    EngineeredYES
    Expression SystemDESULFOVIBRIO VULGARIS
    Expression System PlasmidPT7
    Expression System Taxid881
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificDESULFOVIBRIO VULGARIS
    Organism Taxid881

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:10 , THR A:11 , THR A:12 , GLY A:13 , ASN A:14 , THR A:15 , SER A:58 , THR A:59 , TRP A:60 , GLY A:61 , CYS A:93 , GLY A:94 , ASP A:95 , TYR A:98 , TYR A:100 , PHE A:101 , CYS A:102 , HOH A:204 , HOH A:218 , HOH A:232 , HOH A:329BINDING SITE FOR RESIDUE FMN A 149

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:64 -A:64

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WSW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WSW)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FLAVODOXIN_LIKEPS50902 Flavodoxin-like domain profile.FLAV_DESVH4-145  1A:4-145
2FLAVODOXINPS00201 Flavodoxin signature.FLAV_DESVH6-22  1A:6-22
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FLAVODOXIN_LIKEPS50902 Flavodoxin-like domain profile.FLAV_DESVH4-145  2A:4-145
2FLAVODOXINPS00201 Flavodoxin signature.FLAV_DESVH6-22  2A:6-22

(-) Exons   (0, 0)

(no "Exon" information available for 1WSW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:147
 aligned with FLAV_DESVH | P00323 from UniProtKB/Swiss-Prot  Length:148

    Alignment length:147
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       
           FLAV_DESVH     2 PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI 148
               SCOP domains d1wswa_ A: Flavodoxin                                                                                                                               SCOP domains
               CATH domains 1wswA00 A:2-148  [code=3.40.50.360, no name defined]                                                                                                CATH domains
               Pfam domains ----Flavodoxin_1-1wswA01 A:6-140                                                                                                           -------- Pfam domains
         Sec.struct. author .eeeeeee...hhhhhhhhhhhhhhhhh..eeeeee.hhh..........eeeeee.ee.....ee...hhhhhhhhhhh.....eeeeeeee.......hhhhhhhhhhhhhh..ee....eeee.hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --FLAVODOXIN_LIKE  PDB: A:4-145 UniProt: 4-145                                                                                                  --- PROSITE (1)
                PROSITE (2) ----FLAVODOXIN       ------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1wsw A   2 AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI 148
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (FLAV_DESVH | P00323)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wsw)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wsw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FLAV_DESVH | P00323
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FLAV_DESVH | P00323
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FLAV_DESVH | P003231akq 1akr 1akt 1aku 1akv 1akw 1azl 1bu5 1c7e 1c7f 1f4p 1fx1 1i1o 1j8q 1j9e 1j9g 1wsb 1xt6 1xyv 1xyy 2fx2 3fx2 4fx2 5fx2 5tgz 5v56 5v57 5xr8 5xra

(-) Related Entries Specified in the PDB File

1wsb THE SAME PROTEIN IN THE SEMIREDUCED FORM AT 1.80 A
1xyv THE SAME PROTEIN IN THE SEMIREDUCED FORM AT 1.79 A
1xyy THE SAME PROTEIN IN THE SEMIREDUCED FORM AT 1.70 A