1WQ6 - JenaLib

Title :   THE TETRAMER STRUCTURE OF THE NERVY HOMOLGY TWO (NHR2) DOMAIN OF AML1-ETO IS CRITICAL FOR AML1-ETO'S ACTIVITY

Authors :   Y. Liu, M. D. Cheney, M. Chruszcz, S. M. Lukasik, K. L. Hartman, T. M. Laue Z. Dauter, W. Minor, N. A. Speck, J. H. Bushweller

Date :   23 Sep 04 (Deposition) - 04 Oct 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Nhr2, Eto, Aml1-Eto, Oncoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Liu, M. D. Cheney, J. J. Gaudet, M. Chruszcz, S. M. Lukasik, D. Sugiyama, J. Lary, J. Cole, Z. Dauter, W. Minor, N. A. Speck, J. H. Bushweller
The Tetramer Structure Of The Nervy Homology Two Domain, Nhr2, Is Critical For Aml1/Eto'S Activity
Cancer Cell V. 9 249 2006
PubMed-ID: 16616331 | Reference-DOI: 10.1016/J.CCR.2006.03.012

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

Asymmetric Unit (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036321	R	386	W	MTG8_HUMAN	Unclassified	---	A/B	R	55	W
2	CancerSNP	VAR_MTG8_HUMAN_CCDS6256_1_01 *	R	386	W	MTG8_HUMAN	Disease (Colorectal cancer)	---	A/B	R	55	W
3	UniProt	VAR_036322	R	395	W	MTG8_HUMAN	Unclassified	---	A/B	R	64	W
4	CancerSNP	VAR_MTG8_HUMAN_CCDS6256_1_02 *	R	395	W	MTG8_HUMAN	Disease (Colorectal cancer)	---	A/B	R	64	W
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 16)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036321	R	386	W	MTG8_HUMAN	Unclassified	---	A/B	R	55	W
2	CancerSNP	VAR_MTG8_HUMAN_CCDS6256_1_01 *	R	386	W	MTG8_HUMAN	Disease (Colorectal cancer)	---	A/B	R	55	W
3	UniProt	VAR_036322	R	395	W	MTG8_HUMAN	Unclassified	---	A/B	R	64	W
4	CancerSNP	VAR_MTG8_HUMAN_CCDS6256_1_02 *	R	395	W	MTG8_HUMAN	Disease (Colorectal cancer)	---	A/B	R	64	W
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (2, 4)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:59
 aligned with MTG8_HUMAN | Q06455 from UniProtKB/Swiss-Prot  Length:604

    Alignment length:59
                                   351       361       371       381       391         
           MTG8_HUMAN   342 DHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAE 400
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------W--------W----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------W--------W----- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.18b        Exon 1.19  PDB: A:29-69 UniProt: 360-427  Transcript 1
                 1wq6 A  11 DHRLTDREWAEEWKHLDHLLNCImDmVEKTRRSLTVLRRCQEADREELNYWIRRYSDAE  69
                                    20        30   | |  40        50        60         
                                                  34-MSE                               
                                                    36-MSE

Chain B from PDB  Type:PROTEIN  Length:59
 aligned with MTG8_HUMAN | Q06455 from UniProtKB/Swiss-Prot  Length:604

    Alignment length:59
                                   351       361       371       381       391         
           MTG8_HUMAN   342 DHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAE 400
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
           Pfam domains (1) NHR2-1wq6B01 B:11-69                                        Pfam domains (1)
           Pfam domains (2) NHR2-1wq6B02 B:11-69                                        Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------W--------W----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------W--------W----- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.18b        Exon 1.19  PDB: B:29-69 UniProt: 360-427  Transcript 1
                 1wq6 B  11 DHRLTDREWAEEWKHLDHLLNCImDmVEKTRRSLTVLRRCQEADREELNYWIRRYSDAE  69
                                    20        30   | |  40        50        60         
                                                  34-MSE                               
                                                    36-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (15, 15)

Asymmetric Unit(hide GO term definitions)

Chain A,B (MTG8_HUMAN | Q06455)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003714	transcription corepressor activity	Interacting selectively and non-covalently with a repressing transcription factor and also with the basal transcription machinery in order to stop, prevent, or reduce the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between repressive transcription factors and the basal transcription machinery.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0006091	generation of precursor metabolites and energy	The chemical reactions and pathways resulting in the formation of precursor metabolites, substances from which energy is derived, and any process involved in the liberation of energy from these substances.
	GO:0045599	negative regulation of fat cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of adipocyte differentiation.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0016363	nuclear matrix	The dense fibrillar network lying on the inner side of the nuclear membrane.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1wq6)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wq6)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1wq6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MTG8_HUMAN \| Q06455
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description