|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 7)| Asymmetric/Biological Unit (4, 7) |
Sites (9, 9)
Asymmetric Unit (9, 9)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1VRK) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1VRK) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VRK) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VRK) |
Exons (0, 0)| (no "Exon" information available for 1VRK) |
Sequences/Alignments
Asymmetric/Biological Unit
Chain A from PDB Type:PROTEIN Length:148
SCOP domains d1vrka_ A: Calmodulin SCOP domains
CATH domains ----1vrkA01 A:5-78 EF-hand 1vrkA02 A:79-146 EF-hand -- CATH domains
Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
1vrk A 1 ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK 148
10 20 30 40 50 60 70 80 90 100 110 120 130 140
Chain B from PDB Type:PROTEIN Length:21 aligned with MYLK_CHICK | P11799 from UniProtKB/Swiss-Prot Length:1906 Alignment length:36 1740 1750 1760 MYLK_CHICK 1731 RRKWQKTGHAVRAIGRLSSMAMISGMSGRKASGSSP 1766 SCOP domains ------------------------------------ SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript ------------------------------------ Transcript 1vrk B 1 RRKwQKTGHAVRAIGRLS---------------SSx 21 | 10 | - - | | | 18 19 | 4-TRF 21-NH2
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1VRK) |
Gene Ontology (16, 16)|
Asymmetric/Biological Unit(hide GO term definitions) Chain B (MYLK_CHICK | P11799)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|