1UVQ - JenaLib

Asymmetric/Biological Unit (123, 123)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
001	UniProt	VAR_050382	D	25	G	DQA1_HUMAN	Polymorphism	12722042	A	D	2	G
002	UniProt	VAR_062688	S	35	P	DQB1_HUMAN	Polymorphism	12722106	B	S	3	P
003	UniProt	VAR_062689	Y	41	F	DQB1_HUMAN	Polymorphism	9274407	B	F	9	F
004	UniProt	VAR_062690	Y	41	L	DQB1_HUMAN	Polymorphism	---	B	F	9	L
005	UniProt	VAR_060494	Y	34	C	DQA1_HUMAN	Polymorphism	1129740	A	C	11	C
006	UniProt	VAR_062691	F	43	L	DQB1_HUMAN	Polymorphism	56173496	B	F	11	L
007	UniProt	VAR_061472	A	45	G	DQB1_HUMAN	Polymorphism	1130375	B	G	13	G
008	UniProt	VAR_061473	M	46	L	DQB1_HUMAN	Polymorphism	1130368	B	M	14	L
009	UniProt	VAR_033401	S	41	F	DQA1_HUMAN	Polymorphism	1071630	A	F	18	F
010	UniProt	VAR_060495	P	44	L	DQA1_HUMAN	Polymorphism	41549715	A	P	21	L
011	UniProt	VAR_062692	R	55	L	DQB1_HUMAN	Polymorphism	41540813	B	R	23	L
012	UniProt	VAR_033402	Y	48	F	DQA1_HUMAN	Polymorphism	12722051	A	Y	25	F
013	UniProt	VAR_062693	Y	58	G	DQB1_HUMAN	Polymorphism	---	B	L	26	G
014	UniProt	VAR_062694	Y	58	L	DQB1_HUMAN	Polymorphism	766817072	B	L	26	L
015	UniProt	VAR_033403	T	49	S	DQA1_HUMAN	Polymorphism	3188011	A	T	26	S
016	UniProt	VAR_062695	V	59	L	DQB1_HUMAN	Polymorphism	41563539	B	V	27	L
017	UniProt	VAR_062696	T	60	S	DQB1_HUMAN	Polymorphism	9274405	B	T	28	S
018	UniProt	VAR_062697	Y	62	H	DQB1_HUMAN	Polymorphism	281862065	B	Y	30	H
019	UniProt	VAR_062698	Y	62	S	DQB1_HUMAN	Polymorphism	---	B	Y	30	S
020	UniProt	VAR_014604	Q	57	E	DQA1_HUMAN	Polymorphism	10093	A	Q	34	E
021	UniProt	VAR_062699	Y	69	D	DQB1_HUMAN	Polymorphism	1130370	B	Y	37	D
022	UniProt	VAR_062700	Y	69	I	DQB1_HUMAN	Polymorphism	---	B	Y	37	I
023	UniProt	VAR_062701	A	70	T	DQB1_HUMAN	Polymorphism	45519640	B	A	38	T
024	UniProt	VAR_062702	A	70	V	DQB1_HUMAN	Polymorphism	1063318	B	A	38	V
025	UniProt	VAR_060496	G	63	E	DQA1_HUMAN	Polymorphism	1142323	A	E	40	E
026	UniProt	VAR_050383	R	64	K	DQA1_HUMAN	Polymorphism	36219699	A	R	41	K
027	UniProt	VAR_060497	T	67	A	DQA1_HUMAN	Polymorphism	41543221	A	T	44	A
028	UniProt	VAR_060498	V	68	A	DQA1_HUMAN	Polymorphism	1142324	A	A	45	A
029	UniProt	VAR_062703	E	77	G	DQB1_HUMAN	Polymorphism	1049083	B	G	45	G
030	UniProt	VAR_062704	V	78	E	DQB1_HUMAN	Polymorphism	9274398	B	V	46	E
031	UniProt	VAR_062705	Y	79	F	DQB1_HUMAN	Polymorphism	9274397	B	Y	47	F
032	UniProt	VAR_060499	C	70	K	DQA1_HUMAN	Polymorphism	---	A	R	47	K
033	UniProt	VAR_060500	C	70	Q	DQA1_HUMAN	Polymorphism	---	A	R	47	Q
034	UniProt	VAR_060501	C	70	R	DQA1_HUMAN	Polymorphism	1142326	A	R	47	R
035	UniProt	VAR_033404	C	70	Y	DQA1_HUMAN	Polymorphism	3207983	A	R	47	Y
036	UniProt	VAR_060502	L	71	W	DQA1_HUMAN	Polymorphism	1142328	A	W	48	W
037	UniProt	VAR_062706	A	81	V	DQB1_HUMAN	Polymorphism	41558214	B	A	49	V
038	UniProt	VAR_033406	V	73	D	DQA1_HUMAN	Polymorphism	760671632	A	E	50	D
039	UniProt	VAR_060503	V	73	E	DQA1_HUMAN	Polymorphism	3208105	A	E	50	E
040	UniProt	VAR_033405	V	73	L	DQA1_HUMAN	Polymorphism	12722061	A	E	50	L
041	UniProt	VAR_060504	L	74	F	DQA1_HUMAN	Polymorphism	9272698	A	F	51	F
042	UniProt	VAR_060505	R	75	H	DQA1_HUMAN	Polymorphism	---	A	S	52	H
043	UniProt	VAR_062707	P	84	L	DQB1_HUMAN	Polymorphism	9274395	B	P	52	L
044	UniProt	VAR_060506	R	75	S	DQA1_HUMAN	Polymorphism	9272699	A	S	52	S
045	UniProt	VAR_060507	Q	76	K	DQA1_HUMAN	Polymorphism	1048052	A	K	53	K
046	UniProt	VAR_062708	L	85	Q	DQB1_HUMAN	Polymorphism	1140313	B	Q	53	Q
047	UniProt	VAR_060508	Q	76	R	DQA1_HUMAN	Polymorphism	12722069	A	K	53	R
048	UniProt	VAR_060509	F	77	L	DQA1_HUMAN	Polymorphism	3188043	A	F	54	L
049	UniProt	VAR_062709	P	87	L	DQB1_HUMAN	Polymorphism	1130380	B	R	55	L
050	UniProt	VAR_062710	P	87	Q	DQB1_HUMAN	Polymorphism	1130380	B	R	55	Q
051	UniProt	VAR_062711	P	87	R	DQB1_HUMAN	Polymorphism	1130380	B	R	55	R
052	UniProt	VAR_033407	R	78	S	DQA1_HUMAN	Polymorphism	36219345	A	G	55	S
053	UniProt	VAR_062712	P	88	L	DQB1_HUMAN	Polymorphism	1130381	B	P	56	L
054	UniProt	VAR_062713	D	89	A	DQB1_HUMAN	Polymorphism	1071637	B	D	57	A
055	UniProt	VAR_062714	D	89	S	DQB1_HUMAN	Polymorphism	---	B	D	57	S
056	UniProt	VAR_062715	D	89	V	DQB1_HUMAN	Polymorphism	1071637	B	D	57	V
057	UniProt	VAR_060512	P	81	R	DQA1_HUMAN	Polymorphism	41541412	A	P	59	R
058	UniProt	VAR_062716	Y	92	N	DQB1_HUMAN	Polymorphism	41562414	B	Y	60	N
059	UniProt	VAR_060513	F	83	G	DQA1_HUMAN	Polymorphism	---	A	G	61	G
060	UniProt	VAR_062717	N	94	K	DQB1_HUMAN	Polymorphism	1130382	B	N	62	K
061	UniProt	VAR_062718	S	95	R	DQB1_HUMAN	Polymorphism	41556215	B	S	63	R
062	UniProt	VAR_033408	T	86	R	DQA1_HUMAN	Polymorphism	1048073	A	R	64	R
063	UniProt	VAR_062719	E	98	D	DQB1_HUMAN	Polymorphism	9274390	B	E	66	D
064	UniProt	VAR_033409	I	88	M	DQA1_HUMAN	Polymorphism	1048080	A	M	66	M
065	UniProt	VAR_062720	V	99	D	DQB1_HUMAN	Polymorphism	41563814	B	V	67	D
066	UniProt	VAR_062721	V	99	I	DQB1_HUMAN	Polymorphism	9274390	B	V	67	I
067	UniProt	VAR_060514	L	91	A	DQA1_HUMAN	Polymorphism	---	A	A	69	A
068	UniProt	VAR_060515	L	91	T	DQA1_HUMAN	Polymorphism	---	A	A	69	T
069	UniProt	VAR_033410	L	91	V	DQA1_HUMAN	Polymorphism	1048085	A	A	69	V
070	UniProt	VAR_062722	R	102	E	DQB1_HUMAN	Polymorphism	---	B	G	70	E
071	UniProt	VAR_062723	R	102	G	DQB1_HUMAN	Polymorphism	1130386	B	G	70	G
072	UniProt	VAR_062724	T	103	A	DQB1_HUMAN	Polymorphism	1130390	B	T	71	A
073	UniProt	VAR_062725	T	103	D	DQB1_HUMAN	Polymorphism	---	B	T	71	D
074	UniProt	VAR_062726	T	103	K	DQB1_HUMAN	Polymorphism	---	B	T	71	K
075	UniProt	VAR_062727	E	106	A	DQB1_HUMAN	Polymorphism	1130387	B	E	74	A
076	UniProt	VAR_062728	E	106	S	DQB1_HUMAN	Polymorphism	---	B	E	74	S
077	UniProt	VAR_060516	S	97	I	DQA1_HUMAN	Polymorphism	9279910	A	I	75	I
078	UniProt	VAR_062729	L	107	V	DQB1_HUMAN	Polymorphism	9274384	B	L	75	V
079	UniProt	VAR_060517	L	98	M	DQA1_HUMAN	Polymorphism	1064944	A	M	76	M
080	UniProt	VAR_060518	L	98	V	DQA1_HUMAN	Polymorphism	1064944	A	M	76	V
081	UniProt	VAR_062730	T	109	R	DQB1_HUMAN	Polymorphism	1130392	B	T	77	R
082	UniProt	VAR_060519	R	101	C	DQA1_HUMAN	Polymorphism	41542116	A	R	79	C
083	UniProt	VAR_050384	S	102	Y	DQA1_HUMAN	Polymorphism	1129808	A	Y	80	Y
084	UniProt	VAR_062731	Q	116	E	DQB1_HUMAN	Polymorphism	1140316	B	E	84	E
085	UniProt	VAR_062732	L	117	V	DQB1_HUMAN	Polymorphism	1140317	B	V	85	V
086	UniProt	VAR_062733	E	118	A	DQB1_HUMAN	Polymorphism	9274380	B	A	86	A
087	UniProt	VAR_062734	E	118	G	DQB1_HUMAN	Polymorphism	9274380	B	A	86	G
088	UniProt	VAR_062735	L	119	F	DQB1_HUMAN	Polymorphism	9274379	B	F	87	F
089	UniProt	VAR_062736	L	119	Y	DQB1_HUMAN	Polymorphism	---	B	F	87	Y
090	UniProt	VAR_062737	T	121	G	DQB1_HUMAN	Polymorphism	---	B	G	89	G
091	UniProt	VAR_062738	T	122	I	DQB1_HUMAN	Polymorphism	1140320	B	I	90	I
092	UniProt	VAR_060520	L	124	V	DQA1_HUMAN	Polymorphism	41555012	A	L	102	V
093	UniProt	VAR_050385	I	129	T	DQA1_HUMAN	Polymorphism	707952	A	T	107	T
094	UniProt	VAR_056571	V	148	I	DQB1_HUMAN	Polymorphism	1049100	B	V	116	I
095	UniProt	VAR_062739	A	157	G	DQB1_HUMAN	Polymorphism	1063322	B	G	125	G
096	UniProt	VAR_062740	A	157	S	DQB1_HUMAN	Polymorphism	---	B	G	125	S
097	UniProt	VAR_062741	Q	158	H	DQB1_HUMAN	Polymorphism	41542812	B	Q	126	H
098	UniProt	VAR_050386	H	151	Q	DQA1_HUMAN	Polymorphism	707950	A	Q	129	Q
099	UniProt	VAR_060521	S	152	A	DQA1_HUMAN	Polymorphism	41547417	A	S	130	A
100	UniProt	VAR_062742	R	162	Q	DQB1_HUMAN	Polymorphism	41544112	B	R	130	Q
101	UniProt	VAR_062744	R	165	Q	DQB1_HUMAN	Polymorphism	9273989	B	R	133	Q
102	UniProt	VAR_062743	R	165	W	DQB1_HUMAN	Polymorphism	63626961	B	R	133	W
103	UniProt	VAR_062745	D	167	G	DQB1_HUMAN	Polymorphism	2647032	B	D	135	G
104	UniProt	VAR_062746	Q	168	E	DQB1_HUMAN	Polymorphism	9273981	B	Q	136	E
105	UniProt	VAR_060522	T	160	I	DQA1_HUMAN	Polymorphism	41545514	A	T	138	I
106	UniProt	VAR_060524	S	161	I	DQA1_HUMAN	Polymorphism	41544114	A	S	139	I
107	UniProt	VAR_060523	S	161	R	DQA1_HUMAN	Polymorphism	41552014	A	S	139	R
108	UniProt	VAR_062747	T	172	A	DQB1_HUMAN	Polymorphism	1063323	B	A	140	A
109	UniProt	VAR_060525	Y	175	H	DQA1_HUMAN	Polymorphism	41550317	A	Y	153	H
110	UniProt	VAR_060526	L	178	F	DQA1_HUMAN	Polymorphism	707949	A	F	156	F
111	UniProt	VAR_060527	A	182	D	DQA1_HUMAN	Polymorphism	7990	A	A	160	D
112	UniProt	VAR_060528	A	182	S	DQA1_HUMAN	Polymorphism	41561312	A	A	160	S
113	UniProt	VAR_060529	E	183	D	DQA1_HUMAN	Polymorphism	707963	A	D	161	D
114	UniProt	VAR_056572	E	194	D	DQB1_HUMAN	Polymorphism	9273952	B	E	162	D
115	UniProt	VAR_060530	S	185	I	DQA1_HUMAN	Polymorphism	707962	A	I	163	I
116	UniProt	VAR_059522	P	197	L	DQB1_HUMAN	Polymorphism	9273948	B	P	165	L
117	UniProt	VAR_062748	H	199	R	DQB1_HUMAN	Polymorphism	701564	B	R	167	R
118	UniProt	VAR_062750	V	202	I	DQB1_HUMAN	Polymorphism	80255621	B	V	170	I
119	UniProt	VAR_060531	K	197	E	DQA1_HUMAN	Polymorphism	2308891	A	Q	175	E
120	UniProt	VAR_060532	K	197	Q	DQA1_HUMAN	Polymorphism	2308891	A	Q	175	Q
121	UniProt	VAR_062751	N	214	S	DQB1_HUMAN	Polymorphism	1130398	B	S	182	S
122	UniProt	VAR_062752	T	217	I	DQB1_HUMAN	Polymorphism	1130399	B	T	185	I
123	UniProt	VAR_062753	V	218	A	DQB1_HUMAN	Polymorphism	281864132	B	V	186	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 2)

Exons (6, 6)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:183
 aligned with DQA1_HUMAN | P01909 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:200
                                                                                  79                                                                                                                                                
                                                                                78 |                                                                                                                                                
                                    34        44        54        64        74   | |  83        93       103       113       123       133       143       153       163       173       183       193       203       213       223
          DQA1_HUMAN     25 DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFR-FDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALG  223
               SCOP domains d1uvqa2 A:2-84 Class II MHC alpha chain, N-terminal domain                         d1uvqa1 A:85-183 Class II MHC alpha chain, C-terminal domain                                       ------------------ SCOP domains
               CATH domains ---1uvqA01 A:5-84                                                                  1uvqA02 A:85-183 Immunoglobulins                                                                   ------------------ CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee....eeeeeeee..eeeeeee....eee..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeeee..eee...eee...ee.....eeeeeeeee.......eeeeee.......eeee...-----------------. Sec.struct. author
             SAPs(SNPs) (1) G--------C------F--L---FS-------E-----EK--AA-KW-DFHKLS---R-G--R-M--A-----IM--CY---------------------V----T---------------------QA-------II-------------H--F---DD-I-----------E-------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------Q--E-SR---------------T------V--------------------------------------------------------------R--------------------S--------------Q-------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------------------------R--L------------------V------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------------------------------------Y---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1uvq A    2 DIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEP-----------------G 1186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181 |       -      1186
                                                                                                                                                                                                               183              1186

Chain A from PDB  Type:PROTEIN  Length:183
 aligned with E9PMV2_HUMAN | E9PMV2 from UniProtKB/TrEMBL  Length:214

    Alignment length:187
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       
        E9PMV2_HUMAN     25 DIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWGASPSTG  211
               SCOP domains d1uvqa2 A:2-84 Class II MHC alpha chain, N-terminal domain                         d1uvqa1 A:85-183 Class II MHC alpha chain, C-terminal domain                                       ----- SCOP domains
               CATH domains ---1uvqA01 A:5-84                                                                  1uvqA02 A:85-183 Immunoglobulins                                                                   ----- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee....eeeeeeee..eeeeeee....eee..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeeee..eee...eee...ee.....eeeeeeeee.......eeeeee.......eeee...----. Sec.struct. author
             SAPs(SNPs) (1) G--------C------F--L---FS-------E-----EK--AA-KW-DFHKLS---R-G--R-M--A-----IM--CY---------------------V----T---------------------QA-------II-------------H--F---DD-I-----------E------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------Q--E-SR---------------T------V--------------------------------------------------------------R--------------------S--------------Q------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------------------------R--L------------------V----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------------------------------------Y--------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1uvq A    2 DIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEP----G 1186
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181 |    |
                                                                                                                                                                                                               183 1186

Chain B from PDB  Type:PROTEIN  Length:181
 aligned with DQB1_HUMAN | P01920 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:189
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214         
          DQB1_HUMAN     35 SPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQ  223
               SCOP domains d1uvqb2 B:3-94 Class II MHC beta chain, N-terminal domain                                   d1uvqb1 B:        95-191 Class II MHC beta chain, C-terminal domain                               SCOP domains
               CATH domains 1uvqB01 B:3-92 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1       1uvqB02 B:93        -191 Immunoglobulins                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee....eeeeeeeeee..eeeeeee.....eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee.--------.eeeeeeeee.....eeeeee..eee...eee...ee.....eeeeeeee........eeeeee.......eeeee... Sec.struct. author
             SAPs(SNPs) (1) P-----F-L-GL--------L--GLS-H------DT------GEF-V--LQ-LLA--N-KR--DD--EA--AV-R------EVAF-GI-------------------------I--------GH---Q--Q-GE---A---------------------D--L-R--I-----------S--IA----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------L----------------L---S------IV----------------Q-S---------I--GD--S-----------GY-------------------------------------S-------W---------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------R-V-------------K------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC -------------- PROSITE
           Transcript 2 (1) 2.8-----------------------------------------------------------------------------------------Exon 2.9e  PDB: B:95-189 (gaps) UniProt: 127-221                                               -- Transcript 2 (1)
           Transcript 2 (2) --Exon 2.9a  PDB: B:5-95 UniProt: 37-127                                                     ---------------------------------------------------------------------------------------------2.9 Transcript 2 (2)
                1uvq B    3 SPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPS--------NLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQ  191
                                    12        22        32        42        52        62        72        82        92       102 |       -|      122       132       142       152       162       172       182         
                                                                                                                               104      113

Chain C from PDB  Type:PROTEIN  Length:20
 aligned with OREX_HUMAN | O43612 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:65
                                    10        20        30        40        50        60     
          OREX_HUMAN      1 MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILT   65
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .............-----------------------------------------...----.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
               Transcript 1 1.1    Exon 1.2  PDB: C:8-20 (gaps) UniProt: 8-131 [INCOMPLETE]   Transcript 1
                1uvq C    1 MNLPSTKVSWAAV-----------------------------------------GGG----GSLV   20
                                    10  |      -         -         -         -    | |  - |   
                                       13                                        14 |   17   
                                                                                   16

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (4, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (59, 95)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (DQA1_HUMAN | P01909)

molecular function
	GO:0032395	MHC class II receptor activity	Combining with an MHC class II protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain A (E9PMV2_HUMAN | E9PMV2)

biological process
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
cellular component
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain B (DQB1_HUMAN | P01920)

molecular function
	GO:0032395	MHC class II receptor activity	Combining with an MHC class II protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0002455	humoral immune response mediated by circulating immunoglobulin	An immune response dependent upon secreted immunoglobulin. An example of this process is found in Mus musculus.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0002381	immunoglobulin production involved in immunoglobulin mediated immune response	The appearance of immunoglobulin due to biosynthesis or secretion following a cellular stimulus during an immune response, resulting in an increase in its intracellular or extracellular levels.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain C (OREX_HUMAN | O43612)

molecular function
	GO:0005184	neuropeptide hormone activity	The action characteristic of a neuropeptide hormone, any peptide hormone that acts in the central nervous system. A neuropeptide is any of several types of molecules found in brain tissue, composed of short chains of amino acids; they include endorphins, enkephalins, vasopressin, and others. They are often localized in axon terminals at synapses and are classified as putative neurotransmitters, although some are also hormones.
	GO:0031771	type 1 hypocretin receptor binding	Interacting selectively and non-covalently with a type 1 hypocretin receptor.
	GO:0031772	type 2 hypocretin receptor binding	Interacting selectively and non-covalently with a type 2 hypocretin receptor.
biological process
	GO:0007268	chemical synaptic transmission	The vesicular release of classical neurotransmitter molecules from a presynapse, across a chemical synapse, the subsequent activation of neurotransmitter receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
	GO:0042755	eating behavior	The specific behavior of an organism relating to the intake of food, any substance (usually solid) that can be metabolized by an organism to give energy and build tissue.
	GO:0060079	excitatory postsynaptic potential	A process that leads to a temporary increase in postsynaptic potential due to the flow of positively charged ions into the postsynaptic cell. The flow of ions that causes an EPSP is an excitatory postsynaptic current (EPSC) and makes it easier for the neuron to fire an action potential.
	GO:0007631	feeding behavior	Behavior associated with the intake of food.
	GO:0008156	negative regulation of DNA replication	Any process that stops, prevents, or reduces the frequency, rate or extent of DNA replication.
	GO:0043267	negative regulation of potassium ion transport	Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051970	negative regulation of transmission of nerve impulse	Any process that stops, prevents, or reduces the frequency, rate or extent of transmission of a nerve impulse, the sequential electrochemical polarization and depolarization that travels across the membrane of a neuron in response to stimulation.
	GO:0007218	neuropeptide signaling pathway	The series of molecular signals generated as a consequence of a peptide neurotransmitter binding to a cell surface receptor.
	GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds with activation of phospholipase C (PLC) and a subsequent increase in the concentration of inositol trisphosphate (IP3) and diacylglycerol (DAG).
	GO:0051928	positive regulation of calcium ion transport	Any process that activates or increases the frequency, rate or extent of the directed movement of calcium ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0007204	positive regulation of cytosolic calcium ion concentration	Any process that increases the concentration of calcium ions in the cytosol.
	GO:0051971	positive regulation of transmission of nerve impulse	Any process that activates, maintains or increases the frequency, rate or extent of transmission of a nerve impulse, the sequential electrochemical polarization and depolarization that travels across the membrane of a neuron in response to stimulation.
	GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds with activation of protein kinase C (PKC). PKC is activated by second messengers including diacylglycerol (DAG).
	GO:0046928	regulation of neurotransmitter secretion	Any process that modulates the frequency, rate or extent of the regulated release of a neurotransmitter from a cell.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0098794	postsynapse	The part of a synapse that is part of the post-synaptic cell.
	GO:0005791	rough endoplasmic reticulum	The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.
	GO:0030141	secretory granule	A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.
	GO:0008021	synaptic vesicle	A secretory organelle, typically 50 nm in diameter, of presynaptic nerve terminals; accumulates in high concentrations of neurotransmitters and secretes these into the synaptic cleft by fusion with the 'active zone' of the presynaptic plasma membrane.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (6, 9)

Sites (6, 6)

SS Bonds (3, 3)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (123, 123)

PROSITE Motifs (1, 2)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (4, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (59, 95)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File