1NBN - JenaLib

Theoretical Model (122, 122)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
001	UniProt	VAR_062688	S	35	P	DQB1_HUMAN	Polymorphism	12722106	B	S	1	P
002	UniProt	VAR_062689	Y	41	F	DQB1_HUMAN	Polymorphism	9274407	B	Y	7	F
003	UniProt	VAR_062690	Y	41	L	DQB1_HUMAN	Polymorphism	---	B	Y	7	L
004	UniProt	VAR_060494	Y	34	C	DQA1_HUMAN	Polymorphism	1129740	A	Y	8	C
005	UniProt	VAR_062691	F	43	L	DQB1_HUMAN	Polymorphism	56173496	B	F	9	L
006	UniProt	VAR_061472	A	45	G	DQB1_HUMAN	Polymorphism	1130375	B	G	11	G
007	UniProt	VAR_061473	M	46	L	DQB1_HUMAN	Polymorphism	1130368	B	M	12	L
008	UniProt	VAR_033401	S	41	F	DQA1_HUMAN	Polymorphism	1071630	A	S	15	F
009	UniProt	VAR_060495	P	44	L	DQA1_HUMAN	Polymorphism	41549715	A	P	18	L
010	UniProt	VAR_062692	R	55	L	DQB1_HUMAN	Polymorphism	41540813	B	R	21	L
011	UniProt	VAR_033402	Y	48	F	DQA1_HUMAN	Polymorphism	12722051	A	Y	22	F
012	UniProt	VAR_033403	T	49	S	DQA1_HUMAN	Polymorphism	3188011	A	T	23	S
013	UniProt	VAR_062693	Y	58	G	DQB1_HUMAN	Polymorphism	---	B	L	24	G
014	UniProt	VAR_062694	Y	58	L	DQB1_HUMAN	Polymorphism	766817072	B	L	24	L
015	UniProt	VAR_062695	V	59	L	DQB1_HUMAN	Polymorphism	41563539	B	V	25	L
016	UniProt	VAR_062696	T	60	S	DQB1_HUMAN	Polymorphism	9274405	B	S	26	S
017	UniProt	VAR_062697	Y	62	H	DQB1_HUMAN	Polymorphism	281862065	B	S	28	H
018	UniProt	VAR_062698	Y	62	S	DQB1_HUMAN	Polymorphism	---	B	S	28	S
019	UniProt	VAR_014604	Q	57	E	DQA1_HUMAN	Polymorphism	10093	A	Q	31	E
020	UniProt	VAR_062699	Y	69	D	DQB1_HUMAN	Polymorphism	1130370	B	I	35	D
021	UniProt	VAR_062700	Y	69	I	DQB1_HUMAN	Polymorphism	---	B	I	35	I
022	UniProt	VAR_062701	A	70	T	DQB1_HUMAN	Polymorphism	45519640	B	V	36	T
023	UniProt	VAR_062702	A	70	V	DQB1_HUMAN	Polymorphism	1063318	B	V	36	V
024	UniProt	VAR_060496	G	63	E	DQA1_HUMAN	Polymorphism	1142323	A	G	37	E
025	UniProt	VAR_050383	R	64	K	DQA1_HUMAN	Polymorphism	36219699	A	R	38	K
026	UniProt	VAR_060497	T	67	A	DQA1_HUMAN	Polymorphism	41543221	A	T	41	A
027	UniProt	VAR_060498	V	68	A	DQA1_HUMAN	Polymorphism	1142324	A	V	42	A
028	UniProt	VAR_062703	E	77	G	DQB1_HUMAN	Polymorphism	1049083	B	G	43	G
029	UniProt	VAR_062704	V	78	E	DQB1_HUMAN	Polymorphism	9274398	B	E	44	E
030	UniProt	VAR_060499	C	70	K	DQA1_HUMAN	Polymorphism	---	A	C	44	K
031	UniProt	VAR_060500	C	70	Q	DQA1_HUMAN	Polymorphism	---	A	C	44	Q
032	UniProt	VAR_060501	C	70	R	DQA1_HUMAN	Polymorphism	1142326	A	C	44	R
033	UniProt	VAR_033404	C	70	Y	DQA1_HUMAN	Polymorphism	3207983	A	C	44	Y
034	UniProt	VAR_062705	Y	79	F	DQB1_HUMAN	Polymorphism	9274397	B	F	45	F
035	UniProt	VAR_060502	L	71	W	DQA1_HUMAN	Polymorphism	1142328	A	L	45	W
036	UniProt	VAR_033406	V	73	D	DQA1_HUMAN	Polymorphism	760671632	A	V	47	D
037	UniProt	VAR_060503	V	73	E	DQA1_HUMAN	Polymorphism	3208105	A	V	47	E
038	UniProt	VAR_033405	V	73	L	DQA1_HUMAN	Polymorphism	12722061	A	V	47	L
039	UniProt	VAR_062706	A	81	V	DQB1_HUMAN	Polymorphism	41558214	B	A	47	V
040	UniProt	VAR_060504	L	74	F	DQA1_HUMAN	Polymorphism	9272698	A	L	48	F
041	UniProt	VAR_060505	R	75	H	DQA1_HUMAN	Polymorphism	---	A	R	49	H
042	UniProt	VAR_060506	R	75	S	DQA1_HUMAN	Polymorphism	9272699	A	R	49	S
043	UniProt	VAR_060507	Q	76	K	DQA1_HUMAN	Polymorphism	1048052	A	Q	50	K
044	UniProt	VAR_062707	P	84	L	DQB1_HUMAN	Polymorphism	9274395	B	L	50	L
045	UniProt	VAR_060508	Q	76	R	DQA1_HUMAN	Polymorphism	12722069	A	Q	50	R
046	UniProt	VAR_060509	F	77	L	DQA1_HUMAN	Polymorphism	3188043	A	F	51	L
047	UniProt	VAR_062708	L	85	Q	DQB1_HUMAN	Polymorphism	1140313	B	L	51	Q
048	UniProt	VAR_033407	R	78	S	DQA1_HUMAN	Polymorphism	36219345	A	R	52	S
049	UniProt	VAR_062709	P	87	L	DQB1_HUMAN	Polymorphism	1130380	B	L	53	L
050	UniProt	VAR_062710	P	87	Q	DQB1_HUMAN	Polymorphism	1130380	B	L	53	Q
051	UniProt	VAR_062711	P	87	R	DQB1_HUMAN	Polymorphism	1130380	B	L	53	R
052	UniProt	VAR_062712	P	88	L	DQB1_HUMAN	Polymorphism	1130381	B	P	54	L
053	UniProt	VAR_062713	D	89	A	DQB1_HUMAN	Polymorphism	1071637	B	A	55	A
054	UniProt	VAR_060512	P	81	R	DQA1_HUMAN	Polymorphism	41541412	A	P	55	R
055	UniProt	VAR_062714	D	89	S	DQB1_HUMAN	Polymorphism	---	B	A	55	S
056	UniProt	VAR_062715	D	89	V	DQB1_HUMAN	Polymorphism	1071637	B	A	55	V
057	UniProt	VAR_060513	F	83	G	DQA1_HUMAN	Polymorphism	---	A	F	57	G
058	UniProt	VAR_062716	Y	92	N	DQB1_HUMAN	Polymorphism	41562414	B	Y	58	N
059	UniProt	VAR_062717	N	94	K	DQB1_HUMAN	Polymorphism	1130382	B	N	60	K
060	UniProt	VAR_033408	T	86	R	DQA1_HUMAN	Polymorphism	1048073	A	T	60	R
061	UniProt	VAR_062718	S	95	R	DQB1_HUMAN	Polymorphism	41556215	B	S	61	R
062	UniProt	VAR_033409	I	88	M	DQA1_HUMAN	Polymorphism	1048080	A	I	62	M
063	UniProt	VAR_062719	E	98	D	DQB1_HUMAN	Polymorphism	9274390	B	D	64	D
064	UniProt	VAR_060514	L	91	A	DQA1_HUMAN	Polymorphism	---	A	L	65	A
065	UniProt	VAR_062720	V	99	D	DQB1_HUMAN	Polymorphism	41563814	B	I	65	D
066	UniProt	VAR_062721	V	99	I	DQB1_HUMAN	Polymorphism	9274390	B	I	65	I
067	UniProt	VAR_060515	L	91	T	DQA1_HUMAN	Polymorphism	---	A	L	65	T
068	UniProt	VAR_033410	L	91	V	DQA1_HUMAN	Polymorphism	1048085	A	L	65	V
069	UniProt	VAR_062722	R	102	E	DQB1_HUMAN	Polymorphism	---	B	R	68	E
070	UniProt	VAR_062723	R	102	G	DQB1_HUMAN	Polymorphism	1130386	B	R	68	G
071	UniProt	VAR_062724	T	103	A	DQB1_HUMAN	Polymorphism	1130390	B	K	69	A
072	UniProt	VAR_062725	T	103	D	DQB1_HUMAN	Polymorphism	---	B	K	69	D
073	UniProt	VAR_062726	T	103	K	DQB1_HUMAN	Polymorphism	---	B	K	69	K
074	UniProt	VAR_060516	S	97	I	DQA1_HUMAN	Polymorphism	9279910	A	S	71	I
075	UniProt	VAR_062727	E	106	A	DQB1_HUMAN	Polymorphism	1130387	B	A	72	A
076	UniProt	VAR_060517	L	98	M	DQA1_HUMAN	Polymorphism	1064944	A	L	72	M
077	UniProt	VAR_062728	E	106	S	DQB1_HUMAN	Polymorphism	---	B	A	72	S
078	UniProt	VAR_060518	L	98	V	DQA1_HUMAN	Polymorphism	1064944	A	L	72	V
079	UniProt	VAR_062729	L	107	V	DQB1_HUMAN	Polymorphism	9274384	B	V	73	V
080	UniProt	VAR_060519	R	101	C	DQA1_HUMAN	Polymorphism	41542116	A	R	75	C
081	UniProt	VAR_062730	T	109	R	DQB1_HUMAN	Polymorphism	1130392	B	R	75	R
082	UniProt	VAR_050384	S	102	Y	DQA1_HUMAN	Polymorphism	1129808	A	S	76	Y
083	UniProt	VAR_062731	Q	116	E	DQB1_HUMAN	Polymorphism	1140316	B	Q	82	E
084	UniProt	VAR_062732	L	117	V	DQB1_HUMAN	Polymorphism	1140317	B	L	83	V
085	UniProt	VAR_062733	E	118	A	DQB1_HUMAN	Polymorphism	9274380	B	E	84	A
086	UniProt	VAR_062734	E	118	G	DQB1_HUMAN	Polymorphism	9274380	B	E	84	G
087	UniProt	VAR_062735	L	119	F	DQB1_HUMAN	Polymorphism	9274379	B	L	85	F
088	UniProt	VAR_062736	L	119	Y	DQB1_HUMAN	Polymorphism	---	B	L	85	Y
089	UniProt	VAR_062737	T	121	G	DQB1_HUMAN	Polymorphism	---	B	T	87	G
090	UniProt	VAR_062738	T	122	I	DQB1_HUMAN	Polymorphism	1140320	B	T	88	I
091	UniProt	VAR_060520	L	124	V	DQA1_HUMAN	Polymorphism	41555012	A	L	98	V
092	UniProt	VAR_050385	I	129	T	DQA1_HUMAN	Polymorphism	707952	A	I	103	T
093	UniProt	VAR_056571	V	148	I	DQB1_HUMAN	Polymorphism	1049100	B	V	114	I
094	UniProt	VAR_062739	A	157	G	DQB1_HUMAN	Polymorphism	1063322	B	A	123	G
095	UniProt	VAR_062740	A	157	S	DQB1_HUMAN	Polymorphism	---	B	A	123	S
096	UniProt	VAR_062741	Q	158	H	DQB1_HUMAN	Polymorphism	41542812	B	Q	124	H
097	UniProt	VAR_050386	H	151	Q	DQA1_HUMAN	Polymorphism	707950	A	H	125	Q
098	UniProt	VAR_060521	S	152	A	DQA1_HUMAN	Polymorphism	41547417	A	S	126	A
099	UniProt	VAR_062742	R	162	Q	DQB1_HUMAN	Polymorphism	41544112	B	R	128	Q
100	UniProt	VAR_062744	R	165	Q	DQB1_HUMAN	Polymorphism	9273989	B	R	131	Q
101	UniProt	VAR_062743	R	165	W	DQB1_HUMAN	Polymorphism	63626961	B	R	131	W
102	UniProt	VAR_062745	D	167	G	DQB1_HUMAN	Polymorphism	2647032	B	D	133	G
103	UniProt	VAR_062746	Q	168	E	DQB1_HUMAN	Polymorphism	9273981	B	Q	134	E
104	UniProt	VAR_060522	T	160	I	DQA1_HUMAN	Polymorphism	41545514	A	T	134	I
105	UniProt	VAR_060524	S	161	I	DQA1_HUMAN	Polymorphism	41544114	A	S	135	I
106	UniProt	VAR_060523	S	161	R	DQA1_HUMAN	Polymorphism	41552014	A	S	135	R
107	UniProt	VAR_062747	T	172	A	DQB1_HUMAN	Polymorphism	1063323	B	A	138	A
108	UniProt	VAR_060525	Y	175	H	DQA1_HUMAN	Polymorphism	41550317	A	Y	149	H
109	UniProt	VAR_060526	L	178	F	DQA1_HUMAN	Polymorphism	707949	A	L	152	F
110	UniProt	VAR_060527	A	182	D	DQA1_HUMAN	Polymorphism	7990	A	A	156	D
111	UniProt	VAR_060528	A	182	S	DQA1_HUMAN	Polymorphism	41561312	A	A	156	S
112	UniProt	VAR_060529	E	183	D	DQA1_HUMAN	Polymorphism	707963	A	E	157	D
113	UniProt	VAR_060530	S	185	I	DQA1_HUMAN	Polymorphism	707962	A	S	159	I
114	UniProt	VAR_056572	E	194	D	DQB1_HUMAN	Polymorphism	9273952	B	E	160	D
115	UniProt	VAR_059522	P	197	L	DQB1_HUMAN	Polymorphism	9273948	B	P	163	L
116	UniProt	VAR_062748	H	199	R	DQB1_HUMAN	Polymorphism	701564	B	R	165	R
117	UniProt	VAR_062750	V	202	I	DQB1_HUMAN	Polymorphism	80255621	B	V	168	I
118	UniProt	VAR_060531	K	197	E	DQA1_HUMAN	Polymorphism	2308891	A	K	171	E
119	UniProt	VAR_060532	K	197	Q	DQA1_HUMAN	Polymorphism	2308891	A	K	171	Q
120	UniProt	VAR_062751	N	214	S	DQB1_HUMAN	Polymorphism	1130398	B	S	180	S
121	UniProt	VAR_062752	T	217	I	DQB1_HUMAN	Polymorphism	1130399	B	T	183	I
122	UniProt	VAR_062753	V	218	A	DQB1_HUMAN	Polymorphism	281864132	B	V	184	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 2)

Exons (8, 8)

Sequences/Alignments

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:180
 aligned with DQA1_HUMAN | P01909 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:180
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206
           DQA1_HUMAN    27 VADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE 206
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeee..eeee......eeee.ee..ee..ee......ee..hhhhhh....hhhhhhhhhhhhhhhhhhhhhhh..........eeeee.........eeeeeee............ee..ee....eee............eeeeeee.......ee................... Sec.struct. author
             SAPs(SNPs) (1) -------C------F--L---FS-------E-----EK--AA-KW-DFHKLS--R-G--R-M--A-----IM--CY---------------------V----T---------------------QA-------II-------------H--F---DD-I-----------E--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------Q--E-SR--------------T------V--------------------------------------------------------------R--------------------S--------------Q--------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------------------------R--L-----------------V------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -------------------------------------------Y---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC -------------- PROSITE
           Transcript 2 (1) 2.---------------------------------------------------------------------------------Exon 2.3  PDB: A:84-178 UniProt: 110-204                                                       -- Transcript 2 (1)
           Transcript 2 (2) -Exon 2.2  PDB: A:2-84 UniProt: 28-110                                              ---------------------------------------------------------------------------------------------2.6 Transcript 2 (2)
                 1nbn A   1 VADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE 180
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain B from PDB  Type:PROTEIN  Length:190
 aligned with DQB1_HUMAN | P01920 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:190
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224
           DQB1_HUMAN    35 SPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQS 224
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeee.......eeeeeeee..eeeeeee.....eee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeee..........eeeeeeeeee.....eeeeee..ee....eee...eee...eeeeeeeeee......eeeeeee.......eeeeee... Sec.struct. author
             SAPs(SNPs) (1) P-----F-L-GL--------L--GLS-H------DT------GEF-V--LQ-LLA--N-KR--DD--EA--AV-R------EVAF-GI-------------------------I--------GH---Q--Q-GE---A---------------------D--L-R--I-----------S--IA------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------L----------------L---S------IV----------------Q-S---------I--GD--S-----------GY-------------------------------------S-------W----------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------R-V-------------K------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC --------------- PROSITE
           Transcript 1 (1) 1.8-----------------------------------------------------------------------------------------Exon 1.9e  PDB: B:93-187 UniProt: 127-221                                                      --- Transcript 1 (1)
           Transcript 1 (2) --Exon 1.9a  PDB: B:3-93 UniProt: 37-127                                                     ---------------------------------------------------------------------------------------------1.9g Transcript 1 (2)
                 1nbn B   1 SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQS 190
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (31, 59)

Theoretical Model(hide GO term definitions)

Chain A (DQA1_HUMAN | P01909)

molecular function
	GO:0032395	MHC class II receptor activity	Combining with an MHC class II protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Chain B (DQB1_HUMAN | P01920)

molecular function
	GO:0032395	MHC class II receptor activity	Combining with an MHC class II protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042605	peptide antigen binding	Interacting selectively and non-covalently with an antigen peptide.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
	GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	The process in which an antigen-presenting cell expresses antigen (peptide or polysaccharide) on its cell surface in association with an MHC class II protein complex.
	GO:0002455	humoral immune response mediated by circulating immunoglobulin	An immune response dependent upon secreted immunoglobulin. An example of this process is found in Mus musculus.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0002381	immunoglobulin production involved in immunoglobulin mediated immune response	The appearance of immunoglobulin due to biosynthesis or secretion following a cellular stimulus during an immune response, resulting in an increase in its intracellular or extracellular levels.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
cellular component
	GO:0012507	ER to Golgi transport vesicle membrane	The lipid bilayer surrounding a vesicle transporting substances from the endoplasmic reticulum to the Golgi.
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0042613	MHC class II protein complex	A transmembrane protein complex composed of an MHC class II alpha and MHC class II beta chain, and with or without a bound peptide or polysaccharide antigen.
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0030666	endocytic vesicle membrane	The lipid bilayer surrounding an endocytic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (3, 3)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (122, 122)

PROSITE Motifs (1, 2)

Exons (8, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (31, 59)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File