1PRU - JenaLib

Title :   PURINE REPRESSOR DNA-BINDING DOMAIN DNA BINDING

Authors :   A. Nagadoi, S. Morikawa, H. Nakamura, M. Enari, K. Kobayashi, H. Yamamo G. Sampei, K. Mizobuchi, M. A. Schumacher, R. G. Brennan, Y. Nishimura

Date :   08 May 95 (Deposition) - 08 Mar 96 (Release) - 22 Feb 12 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A
NMR Structure *: A  (1x)

Keywords :   Purine Repressor, Dna-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Nagadoi, S. Morikawa, H. Nakamura, M. Enari, K. Kobayashi, H. Yamamoto, G. Sampei, K. Mizobuchi, M. A. Schumacher, R. G. Brennan, Y. Nishimura
Structural Comparison Of The Free And Dna-Bound Forms Of Th Purine Repressor Dna-Binding Domain.
Structure V. 3 1217 1995
PubMed-ID: 8591032 | Reference-DOI: 10.1016/S0969-2126(01)00257-X
(for further references see the PDB file header)

Compounds

Molecule 1 - PURINE REPRESSOR
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Gene	:	PURR
	Expression System Plasmid	:	PAR2156NCOI
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Fragment	:	DNA-BINDING
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_LACI_2	PS50932	LacI-type HTH domain profile.	PURR_ECOLI	2-56	1	A:2-56
2	HTH_LACI_1	PS00356	LacI-type HTH domain signature.	PURR_ECOLI	4-22	1	A:4-22

NMR Structure * (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_LACI_2	PS50932	LacI-type HTH domain profile.	PURR_ECOLI	2-56	1	A:2-56
2	HTH_LACI_1	PS00356	LacI-type HTH domain signature.	PURR_ECOLI	4-22	1	A:4-22

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:56
 aligned with PURR_ECOLI | P0ACP7 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:56
                                    10        20        30        40        50      
            PURR_ECOLI    1 MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKV 56
               SCOP domains d1prua_ A: Purine repressor (PurR), N-terminal domain    SCOP domains
               CATH domains 1pruA00 A:1-56 lambda repressor-like DNA-binding domains CATH domains
               Pfam domains --LacI-1pruA01 A:3-48                           -------- Pfam domains
         Sec.struct. author ...hhhhhhhh...hhhhhhhhh......hhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -HTH_LACI_2  PDB: A:2-56 UniProt: 2-56                   PROSITE (1)
                PROSITE (2) ---HTH_LACI_1         ---------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------- Transcript
                  1pru A  1 MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKV 56
                                    10        20        30        40        50

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (8, 8)

NMR Structure(hide GO term definitions)

Chain A (PURR_ECOLI | P0ACP7)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006164	purine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pru)

	Sites
(no "Sites" information available for 1pru)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pru)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Midas
	ribbon, secondary structure [ mono GIF format \| stereo GIF format ]
	sticks [ mono GIF format \| stereo GIF format ]
	spacefill [ mono GIF format \| stereo GIF format ]
Weblab
	ribbon, secondary structure, lines, labeling [ mono GIF format \| stereo GIF format ]
	surface, molecular electrostatic coloring [ stereo GIF format \| mono GIF format \| stereo GIF format ]
	ribbon, secondary structure, labeling [ mono GIF format \| stereo GIF format ]

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1pru
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PURR_ECOLI \| P0ACP7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PURR_ECOLI \| P0ACP7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description