|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1PRV) |
Sites (0, 0)| (no "Site" information available for 1PRV) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1PRV) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1PRV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1PRV) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1PRV) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:56 aligned with PURR_ECOLI | P0ACP7 from UniProtKB/Swiss-Prot Length:341 Alignment length:56 10 20 30 40 50 PURR_ECOLI 1 MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKV 56 SCOP domains d1prva_ A: Purine repressor (PurR), N-terminal domain SCOP domains CATH domains 1prvA00 A:1-56 lambda repressor-like DNA-binding domains CATH domains Pfam domains --LacI-1prvA01 A:3-48 -------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (1) -HTH_LACI_2 PDB: A:2-56 UniProt: 2-56 PROSITE (1) PROSITE (2) ---HTH_LACI_1 ---------------------------------- PROSITE (2) Transcript -------------------------------------------------------- Transcript 1prv A 1 MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKV 56 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (PURR_ECOLI | P0ACP7)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|