Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  YEAST MATALPHA2/MCM1/DNA TERNARY TRANSCRIPTION COMPLEX CRYSTAL STRUCTURE
 
Authors :  S. Tan, T. J. Richmond
Date :  03 Nov 97  (Deposition) - 18 Mar 98  (Release) - 15 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Transcription Regulation, Transcriptional Repression, Dna-Binding Protein, Complex (Transcription-Homeobox-Dna), Transcription-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Tan, T. J. Richmond
Crystal Structure Of The Yeast Matalpha2/Mcm1/Dna Ternary Complex.
Nature V. 391 660 1998
PubMed-ID: 9490409  |  Reference-DOI: 10.1038/35563
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA (STE6 OPERATOR DNA)
    Chains: E
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES
 
Molecule 2 - DNA (STE6 OPERATOR DNA)
    Chains: F
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES
 
Molecule 3 - PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: RESIDUES 1 - 100
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: PHEROMONE RECEPTOR TRANSCRIPTION FACTOR
 
Molecule 4 - PROTEIN (MAT ALPHA-2 TRANSCRIPTIONAL REPRESSOR)
    Chains: C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: RESIDUES 113 - 189
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: MATING-TYPE PROTEIN ALPHA-2

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MNM)

(-) Sites  (0, 0)

(no "Site" information available for 1MNM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MNM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MNM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MNM)

(-) PROSITE Motifs  (3, 5)

Asymmetric/Biological Unit (3, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MADS_BOX_2PS50066 MADS-box domain profile.MCM1_YEAST16-76  1A:16-76
2MADS_BOX_1PS00350 MADS-box domain signature.MCM1_YEAST18-72
 		  2A:18-72
B:18-72
3HOMEOBOX_2PS50071 'Homeobox' domain profile.HMAL2_YEAST127-190
 		  2C:127-189
D:127-189
MTAL2_YEAST127-190
 		  2C:127-189
D:127-189

(-) Exons   (2, 4)

Asymmetric/Biological Unit (2, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YCR039C1YCR039C.1III:200174-199542633MTAL2_YEAST1-2102102C:113-189
D:113-189		77
77
2.1YMR043W1YMR043W.1XIII:353870-354730861MCM1_YEAST1-2862862A:15-99
B:18-98		85
81

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:85
 aligned with MCM1_YEAST | P11746 from UniProtKB/Swiss-Prot  Length:286

    Alignment length:85
                                    24        34        44        54        64        74        84        94     
           MCM1_YEAST    15 QKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDD  99
               SCOP domains d1mnma_ A: MCM1 transcriptional regulator                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.....eeeee.hhhhhhhh.hhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -MADS_BOX_2  PDB: A:16-76 UniProt: 16-76                      ----------------------- PROSITE (1)
                PROSITE (2) ---MADS_BOX_1  PDB: A:18-72 UniProt: 18-72                --------------------------- PROSITE (2)
               Transcript 2 Exon 2.1  PDB: A:15-99 UniProt: 1-286 [INCOMPLETE]                                    Transcript 2
                 1mnm A  15 QKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDD  99
                                    24        34        44        54        64        74        84        94     


Chain B from PDB  Type:PROTEIN  Length:81
 aligned with MCM1_YEAST | P11746 from UniProtKB/Swiss-Prot  Length:286

    Alignment length:81
                                    27        37        47        57        67        77        87        97 
           MCM1_YEAST    18 RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPD  98
               SCOP domains d1mnmb_ B: MCM1 transcriptional regulator                                         SCOP domains
               CATH domains --------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.....eeeee.hhhhhhhh.hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) MADS_BOX_2  PDB: - UniProt: 16-76                          ---------------------- PROSITE (1)
                PROSITE (2) MADS_BOX_1  PDB: B:18-72 UniProt: 18-72                -------------------------- PROSITE (2)
               Transcript 2 Exon 2.1  PDB: B:18-98 UniProt: 1-286 [INCOMPLETE]                                Transcript 2
                 1mnm B  18 RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPD  98
                                    27        37        47        57        67        77        87        97 


Chain C from PDB  Type:PROTEIN  Length:77
 aligned with HMAL2_YEAST | P0CY09 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:77
                                   122       132       142       152       162       172       182       
          HMAL2_YEAST   113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
               SCOP domains d1mnmc_ C: mat alpha2 Homeodomain                                             SCOP domains
               CATH domains 1mnmC00 C:113-189 Homeodomain-like                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eee..........hhhhhhhhhhhhhhh......hhhhhhhhhhh...hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------HOMEOBOX_2  PDB: C:127-189 UniProt: 127-190                     PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                 1mnm C 113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
                                   122       132       142       152       162       172       182       


Chain C from PDB  Type:PROTEIN  Length:77
 aligned with MTAL2_YEAST | P0CY08 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:77
                                   122       132       142       152       162       172       182       
          MTAL2_YEAST   113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
               SCOP domains d1mnmc_ C: mat alpha2 Homeodomain                                             SCOP domains
               CATH domains 1mnmC00 C:113-189 Homeodomain-like                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eee..........hhhhhhhhhhhhhhh......hhhhhhhhhhh...hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------HOMEOBOX_2  PDB: C:127-189 UniProt: 127-190                     PROSITE (2)
               Transcript 1 Exon 1.1  PDB: C:113-189 UniProt: 1-210 [INCOMPLETE]                          Transcript 1
                 1mnm C 113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
                                   122       132       142       152       162       172       182       


Chain D from PDB  Type:PROTEIN  Length:77
 aligned with HMAL2_YEAST | P0CY09 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:77
                                   122       132       142       152       162       172       182       
          HMAL2_YEAST   113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
               SCOP domains d1mnmd_ D: mat alpha2 Homeodomain                                             SCOP domains
               CATH domains 1mnmD00 D:113-189 Homeodomain-like                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhh.........hhhhhhhhhhhhhhh......hhhhhhhhhhh...hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------HOMEOBOX_2  PDB: D:127-189 UniProt: 127-190                     PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                 1mnm D 113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
                                   122       132       142       152       162       172       182       


Chain D from PDB  Type:PROTEIN  Length:77
 aligned with MTAL2_YEAST | P0CY08 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:77
                                   122       132       142       152       162       172       182       
          MTAL2_YEAST   113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
               SCOP domains d1mnmd_ D: mat alpha2 Homeodomain                                             SCOP domains
               CATH domains 1mnmD00 D:113-189 Homeodomain-like                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhh.........hhhhhhhhhhhhhhh......hhhhhhhhhhh...hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------HOMEOBOX_2  PDB: D:127-189 UniProt: 127-190                     PROSITE (2)
               Transcript 1 Exon 1.1  PDB: D:113-189 UniProt: 1-210 [INCOMPLETE]                          Transcript 1
                 1mnm D 113 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 189
                                   122       132       142       152       162       172       182       


Chain E from PDB  Type:DNA  Length:26
                                                          
                 1mnm E   1 GATTACCTAATAGGGAAATTTACACG  26
                                    10        20      


Chain F from PDB  Type:DNA  Length:26
                                                          
                 1mnm F  27 CCGTGTAAATTTCCCTATTAGGTAAT  52
                                    36        46
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1MNM)

(-) Gene Ontology  (30, 44)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (MCM1_YEAST | P11746)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003688    DNA replication origin binding    Interacting selectively and non-covalently with the DNA replication origin, a unique DNA sequence of a replicon at which DNA replication is initiated and proceeds bidirectionally or unidirectionally.
    GO:0001102    RNA polymerase II activating transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0044377    RNA polymerase II core promoter proximal region sequence-specific DNA binding, bending    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II and distorting the original structure of DNA, typically a straight helix, into a bend, or increasing the bend if the original structure was intrinsically bent due to its sequence.
    GO:0001103    RNA polymerase II repressing transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription repressing factor, a protein involved in negative regulation of transcription.
    GO:0001133    RNA polymerase II transcription factor activity, sequence-specific transcription regulatory region DNA binding    Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA by RNA polymerase II and recruiting another transcription factor to the DNA in order to modulate transcription by RNAP II.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0001077    transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
    GO:0001078    transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
biological process
    GO:0006270    DNA replication initiation    The process in which DNA-dependent DNA replication is started; this involves the separation of a stretch of the DNA double helix, the recruitment of DNA polymerases and the initiation of polymerase action.
    GO:0006525    arginine metabolic process    The chemical reactions and pathways involving arginine, 2-amino-5-(carbamimidamido)pentanoic acid.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:1900465    negative regulation of arginine catabolic process by negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular arginine catabolic process by stopping, preventing, or reducing the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0001198    negative regulation of mating-type specific transcription from RNA polymerase II promoter    Any mating-type specific process that stops, prevents or reduces the rate of transcription from an RNA polymerase II promoter.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:1900466    positive regulation of arginine biosynthetic process by positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of arginine biosynthetic process by activating or increasing the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0001197    positive regulation of mating-type specific transcription from RNA polymerase II promoter    Any mating-type specific process that activates or increases the rate of transcription from an RNA polymerase II promoter.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0090282    positive regulation of transcription involved in G2/M transition of mitotic cell cycle    Any process that activates or increases the frequency, rate or extent of transcription of target genes that are transcribed as part of the G2/M transition of the mitotic cell cycle.
    GO:0031494    regulation of mating type switching    Any process that modulates the frequency, rate or extent of mating type switching, the conversion of a single-cell organism from one mating type to another by the precise replacement of a DNA sequence at the expressed mating type locus with a copy of a sequence from a donor locus.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0000790    nuclear chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,D   (MTAL2_YEAST | P0CY08)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008301    DNA binding, bending    The activity of binding selectively and non-covalently to and distorting the original structure of DNA, typically a straight helix, into a bend, or increasing the bend if the original structure was intrinsically bent due to its sequence.
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0001227    transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in the regulatory region for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
biological process
    GO:0001198    negative regulation of mating-type specific transcription from RNA polymerase II promoter    Any mating-type specific process that stops, prevents or reduces the rate of transcription from an RNA polymerase II promoter.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,D   (HMAL2_YEAST | P0CY09)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008301    DNA binding, bending    The activity of binding selectively and non-covalently to and distorting the original structure of DNA, typically a straight helix, into a bend, or increasing the bend if the original structure was intrinsically bent due to its sequence.
    GO:0001227    transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in the regulatory region for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
biological process
    GO:0001198    negative regulation of mating-type specific transcription from RNA polymerase II promoter    Any mating-type specific process that stops, prevents or reduces the rate of transcription from an RNA polymerase II promoter.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mnm)
 
  Sites
(no "Sites" information available for 1mnm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1mnm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mnm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HMAL2_YEAST | P0CY09
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MCM1_YEAST | P11746
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MTAL2_YEAST | P0CY08
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HMAL2_YEAST | P0CY09
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MCM1_YEAST | P11746
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MTAL2_YEAST | P0CY08
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HMAL2_YEAST | P0CY09: 1akh 1apl 1k61 1yrn
        MTAL2_YEAST | P0CY08: 1akh 1apl 1k61 1le8 1yrn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MNM)