|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1AWP) |
(no "Cis Peptide Bond" information available for 1AWP) |
(no "SAP(SNP)/Variant" information available for 1AWP) |
Asymmetric/Biological Unit (2, 4)
|
Asymmetric/Biological Unit (3, 6)
|
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:86 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:86 26 36 46 56 66 76 86 96 CYB5B_RAT 17 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP 102 SCOP domains d1awpa_ A: Cytochrome b5 SCOP domains CATH domains 1awpA00 A:1-86 Flavocytochrome B2, subunit A, domain 1 CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---CYTOCHROME_B5_2 PDB: A:4-80 UniProt: 20-96 ------ PROSITE (1) PROSITE (2) ----------------------------------CYTOCHRO-------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: A:1-38 UniProt: 1-54 Exon 1.2 PDB: A:39-81 UniProt: 55-97 1.3 Transcript 1 1awp A 1 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEELLLEQAGADATESFEDLGHSPDAREMLKQYYIGDVHPNDLKP 86 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:86 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:86 26 36 46 56 66 76 86 96 CYB5B_RAT 17 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP 102 SCOP domains d1awpb_ B: Cytochrome b5 SCOP domains CATH domains 1awpB00 B:1-86 Flavocytochrome B2, subunit A, domain 1 CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---CYTOCHROME_B5_2 PDB: B:4-80 UniProt: 20-96 ------ PROSITE (1) PROSITE (2) ----------------------------------CYTOCHRO-------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: B:1-38 UniProt: 1-54 Exon 1.2 PDB: B:39-81 UniProt: 55-97 1.3 Transcript 1 1awp B 1 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEELLLEQAGADATESFEDLGHSPDAREMLKQYYIGDVHPNDLKP 86 10 20 30 40 50 60 70 80
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1AWP) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CYB5B_RAT | P04166)
|
|
|
|
|
|
|