Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5
 
Authors :  V. Oganesyan, X. Zhang
Date :  19 Apr 00  (Deposition) - 04 Apr 01  (Release) - 19 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Cytochrome, Heme, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Wirtz, V. Oganesyan, X. Zhang, J. Studer, M. Rivera
Modulation Of Redox Potential In Electron Transfer Proteins Effects Of Complex Formation On The Active Site Microenvironment Of Cytochrome B5.
Faraday Disc. Chem. Soc V. 116 221 2001
PubMed-ID: 11197480

(-) Compounds

Molecule 1 - CYTOCHROME B5
    CellHEPATOCYTE
    Cellular LocationOUTER MITOCHONDRIAL MEMBRANE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cellular LocationPERIPLASMIC SPACE
    Expression System PlasmidPET 11A
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentWATER SOLUBLE DOMAIN
    MutationYES
    OrganLIVER
    OrganelleMITOCHONDRIA
    Organism CommonNORWAY RAT
    Organism ScientificRATTUS NORVEGICUS
    Organism Taxid10116

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:32 , PHE A:35 , HIS A:39 , PRO A:40 , GLY A:41 , LEU A:46 , SER A:57 , PHE A:58 , ILE A:61 , HIS A:63 , ALA A:67 , LEU A:71 , HOH A:228 , SER B:64 , PRO B:65 , ARG B:68BINDING SITE FOR RESIDUE HEM A 201
2AC2SOFTWAREPHE B:35 , HIS B:39 , PRO B:40 , ILE B:45 , LEU B:46 , GLN B:49 , PHE B:58 , ILE B:61 , HIS B:63 , ALA B:67 , MET B:70 , LEU B:71 , HOH B:221BINDING SITE FOR RESIDUE HEM B 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EUE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1EUE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EUE)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTOCHROME_B5_2PS50255 Cytochrome b5 family, heme-binding domain profile.CYB5B_RAT20-96
 
  2A:4-80
B:4-80
2CYTOCHROME_B5_1PS00191 Cytochrome b5 family, heme-binding domain signature.CYB5B_RAT51-58
 
  2A:35-42
B:35-42
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTOCHROME_B5_2PS50255 Cytochrome b5 family, heme-binding domain profile.CYB5B_RAT20-96
 
  1A:4-80
-
2CYTOCHROME_B5_1PS00191 Cytochrome b5 family, heme-binding domain signature.CYB5B_RAT51-58
 
  1A:35-42
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTOCHROME_B5_2PS50255 Cytochrome b5 family, heme-binding domain profile.CYB5B_RAT20-96
 
  1-
B:4-80
2CYTOCHROME_B5_1PS00191 Cytochrome b5 family, heme-binding domain signature.CYB5B_RAT51-58
 
  1-
B:35-42

(-) Exons   (3, 6)

Asymmetric Unit (3, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000150061ENSRNOE00000104782chr19:37016959-37017126168CYB5B_RAT1-54542A:1-38
B:1-38
38
38
1.2ENSRNOT000000150062ENSRNOE00000105131chr19:37036324-37036452129CYB5B_RAT55-97432A:39-81
B:39-81
43
43
1.3ENSRNOT000000150063ENSRNOE00000105523chr19:37036904-3703693330CYB5B_RAT98-107102A:82-86
B:82-86
5
5
1.4ENSRNOT000000150064ENSRNOE00000105590chr19:37045457-3704548529CYB5B_RAT108-117100--
1.5ENSRNOT000000150065ENSRNOE00000295386chr19:37048353-370507182366CYB5B_RAT117-146300--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:86
 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot  Length:146

    Alignment length:86
                                    26        36        46        56        66        76        86        96      
            CYB5B_RAT    17 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP 102
               SCOP domains d1euea_ A: Cytochrome b5                                                               SCOP domains
               CATH domains 1eueA00 A:1-86 Flavocytochrome B2, subunit A, domain 1                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eehhhhhh..ee..eeeeee..eeee.hhhhhhh...hhhhhh.....hhhhhhhhh.hhhhhhhh...eeeee.hhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---CYTOCHROME_B5_2  PDB: A:4-80 UniProt: 20-96                                  ------ PROSITE (1)
                PROSITE (2) ----------------------------------CYTOCHRO-------------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.1  PDB: A:1-38 UniProt: 1-54   Exon 1.2  PDB: A:39-81 UniProt: 55-97      1.3   Transcript 1
                 1eue A   1 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEILLEQAGADATESFEDIGHSPDAREMLKQYYIGDVHPNDLKP  86
                                    10        20        30        40        50        60        70        80      

Chain B from PDB  Type:PROTEIN  Length:86
 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot  Length:146

    Alignment length:86
                                    26        36        46        56        66        76        86        96      
            CYB5B_RAT    17 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP 102
               SCOP domains d1eueb_ B: Cytochrome b5                                                               SCOP domains
               CATH domains 1eueB00 B:1-86 Flavocytochrome B2, subunit A, domain 1                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eehhhhhhh.ee..eeeeee..eeee.hhhh......hhhhhhh....hhhhhhhh..hhhhhhhhh..eeeee.hhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---CYTOCHROME_B5_2  PDB: B:4-80 UniProt: 20-96                                  ------ PROSITE (1)
                PROSITE (2) ----------------------------------CYTOCHRO-------------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.1  PDB: B:1-38 UniProt: 1-54   Exon 1.2  PDB: B:39-81 UniProt: 55-97      1.3   Transcript 1
                 1eue B   1 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEILLEQAGADATESFEDIGHSPDAREMLKQYYIGDVHPNDLKP  86
                                    10        20        30        40        50        60        70        80      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EUE)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CYB5B_RAT | P04166)
molecular function
    GO:0045153    electron transporter, transferring electrons within CoQH2-cytochrome c reductase complex activity    Enables the directed movement of electrons within the CoQH2-cytochrome c reductase complex.
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0043085    positive regulation of catalytic activity    Any process that activates or increases the activity of an enzyme.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005743    mitochondrial inner membrane    The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
    GO:0005741    mitochondrial outer membrane    The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1eue)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1eue
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYB5B_RAT | P04166
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYB5B_RAT | P04166
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYB5B_RAT | P041661awp 1b5m 1icc 1lj0 2i89 3mus 4hil

(-) Related Entries Specified in the PDB File

1awp