Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  THEORETICAL MODEL OF THE BETA6 INTEGRIN
 
Authors :  S. Rama Devi, S. Tajne, P. Aparna
Date :  17 Apr 02  (Deposition) - 15 May 02  (Release) - 15 May 02  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Rama Devi, S. Tajne, P. Aparna
Theoretical Model Of Beta6 Integrin
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INTEGRIN BETA-6
    ChainsA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1LH9)

(-) Sites  (0, 0)

(no "Site" information available for 1LH9)

(-) SS Bonds  (9, 9)

Theoretical Model
No.Residues
1A:127 -A:134
2A:182 -A:223
3A:324 -A:336
4A:356 -A:384
5A:397 -A:406
6A:411 -A:420
7A:422 -A:449
8A:432 -A:447
9A:441 -A:452

(-) Cis Peptide Bonds  (2, 2)

Theoretical Model
No.Residues
1Val A:392 -Asn A:393
2Leu A:427 -Ser A:428

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 4)

Theoretical Model (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_073328A143TITB6_HUMANDisease (AI1H)140015315AA73T
2UniProtVAR_073329P196TITB6_HUMANDisease (AI1H)730880298AP126T
3UniProtVAR_073330H275QITB6_HUMANDisease (AI1H)730882118AH205Q
4UniProtVAR_049636P437TITB6_HUMANPolymorphism2305820AP367T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Theoretical Model (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EGF_1PS00022 EGF-like domain signature 1.ITB6_HUMAN479-490
563-574
  1A:409-420
-
2INTEGRIN_BETAPS00243 Integrins beta chain cysteine-rich domain signature.ITB6_HUMAN511-524
552-565
591-604
  1A:441-454
-
-

(-) Exons   (8, 8)

Theoretical Model (8, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.7cENST000002832497cENSE00001900255chr2:161056812-161056514299ITB6_HUMAN1-21210--
1.8ENST000002832498ENSE00001716162chr2:161055769-16105569080ITB6_HUMAN21-47270--
1.9bENST000002832499bENSE00001009736chr2:161052931-161052727205ITB6_HUMAN48-116691A:6-4641
1.10ENST0000028324910ENSE00001602800chr2:161052126-161051880247ITB6_HUMAN116-198831A:46-12883
1.12ENST0000028324912ENSE00001663786chr2:161030650-161030485166ITB6_HUMAN198-253561A:128-18356
1.13ENST0000028324913ENSE00001805418chr2:161029241-161029080162ITB6_HUMAN254-307541A:184-23754
1.14ENST0000028324914ENSE00001802948chr2:161025818-16102572396ITB6_HUMAN308-339321A:238-26932
1.15aENST0000028324915aENSE00001602398chr2:160998582-16099849390ITB6_HUMAN340-369301A:270-29930
1.16ENST0000028324916ENSE00001783591chr2:160994710-160994576135ITB6_HUMAN370-414451A:300-34445
1.17ENST0000028324917ENSE00001733188chr2:160994362-160993945418ITB6_HUMAN415-5541401A:345-476132
1.18ENST0000028324918ENSE00001675999chr2:160983112-160982890223ITB6_HUMAN554-628750--
1.19ENST0000028324919ENSE00001803187chr2:160980399-16098030298ITB6_HUMAN628-661340--
1.20aENST0000028324920aENSE00001717546chr2:160968710-160968591120ITB6_HUMAN661-701410--
1.21ENST0000028324921ENSE00001769461chr2:160964356-160964190167ITB6_HUMAN701-756560--
1.22fENST0000028324922fENSE00001215293chr2:160958345-1609561772169ITB6_HUMAN757-788320--

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:471
 aligned with ITB6_HUMAN | P18564 from UniProtKB/Swiss-Prot  Length:788

    Alignment length:471
                                    85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545 
           ITB6_HUMAN    76 ENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVR 546
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................................eeeee....eeee..eee......eeeeeeee.hhhhh.........hhhhhhhhhh....eeeeeeee....hhhhh...hhhhh...............ee.........hhhhhhhhh............hhhhhhhhhhhhhhhh.....eeeeeeee.......hhhhh..................hhhhhh....hhhhhhhhhhhh...eeeeee..hhhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhh....eeee.................................eee..eeee........eeeeeee......eeeeeee..........................................................hhhhhh.eee..eee.................hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------T----------------------------------------------------T------------------------------------------------------------------------------Q-----------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EGF_1       --------------------INTEGRIN_BETA ---------------------- PROSITE
           Transcript 1 (1) ----------------------------------------Exon 1.10  PDB: A:46-128 UniProt: 116-198                                          -------------------------------------------------------Exon 1.13  PDB: A:184-237 UniProt: 254-307            Exon 1.14  PDB: A:238-269       Exon 1.15a  PDB: A:270-299    Exon 1.16  PDB: A:300-344 UniProt: 370-414   Exon 1.17  PDB: A:345-476 UniProt: 415-554 [INCOMPLETE]                                                                              Transcript 1 (1)
           Transcript 1 (2) Exon 1.9b  PDB: A:6-46 UniProt: 48-116   ---------------------------------------------------------------------------------Exon 1.12  PDB: A:128-183 UniProt: 198-253              ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1lh9 A   6 ENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVR 476
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1LH9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1LH9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1LH9)

(-) Gene Ontology  (17, 17)

Theoretical Model(hide GO term definitions)
Chain A   (ITB6_HUMAN | P18564)
molecular function
    GO:0005178    integrin binding    Interacting selectively and non-covalently with an integrin.
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0007229    integrin-mediated signaling pathway    A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0008305    integrin complex    A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1lh9)
 
  Sites
(no "Sites" information available for 1lh9)
 
  Cis Peptide Bonds
    Leu A:427 - Ser A:428   [ RasMol ]  
    Val A:392 - Asn A:393   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1lh9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ITB6_HUMAN | P18564
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  616221
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ITB6_HUMAN | P18564
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ITB6_HUMAN | P185644um8 4um9 5ffg 5ffo 5nem 5ner 5net 5neu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1LH9)