1L5R - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH RIBOFLAVIN, N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE AND CP-403,700

Authors :   J. L. Ekstrom, T. A. Pauly, M. D. Carty, W. C. Soeller, J. Culp, D. E. Danle D. J. Hoover, J. L. Treadway, E. M. Gibbs, R. J. Fletterick, Y. S. N. Day, D. G. Myszka, V. L. Rath

Date :   07 Mar 02 (Deposition) - 04 Dec 02 (Release) - 02 May 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Phosphorylase, Purine Site, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. L. Ekstrom, T. A. Pauly, M. D. Carty, W. C. Soeller, J. Culp, D. E. Danley, D. J. Hoover, J. L. Treadway, E. M. Gibbs, R. J. Fletterick Y. S. Day, D. G. Myszka, V. L. Rath
Structure-Activity Analysis Of The Purine Binding Site Of Human Liver Glycogen Phosphorylase.
Chem. Biol. V. 9 915 2002
PubMed-ID: 12204691 | Reference-DOI: 10.1016/S1074-5521(02)00186-2

Molecule 1 - GLYCOGEN PHOSPHORYLASE, LIVER FORM
	Chains	:	A, B
	EC Number	:	2.4.1.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organ	:	LIVER
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GLYCOGEN PHOSPHORYLASE A

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (5, 6)

No.	Name	Count	Type	Full Name
1	700	1	Ligand/Ion	[5-CHLORO-1H-INDOL-2-CARBONYL-PHENYLALANINYL]-AZETIDINE-3-CARBOXYLIC ACID
2	MRD	1	Ligand/Ion	(4R)-2-METHYLPENTANE-2,4-DIOL
3	NBG	1	Ligand/Ion	1-N-ACETYL-BETA-D-GLUCOSAMINE
4	PLP	2	Ligand/Ion	PYRIDOXAL-5'-PHOSPHATE
5	RBF	1	Ligand/Ion	RIBOFLAVIN

Biological Unit 1 (5, 12)

No.	Name	Count	Type	Full Name
1	700	2	Ligand/Ion	[5-CHLORO-1H-INDOL-2-CARBONYL-PHENYLALANINYL]-AZETIDINE-3-CARBOXYLIC ACID
2	MRD	2	Ligand/Ion	(4R)-2-METHYLPENTANE-2,4-DIOL
3	NBG	2	Ligand/Ion	1-N-ACETYL-BETA-D-GLUCOSAMINE
4	PLP	4	Ligand/Ion	PYRIDOXAL-5'-PHOSPHATE
5	RBF	2	Ligand/Ion	RIBOFLAVIN

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN A:284 , ASP A:339 , HIS A:377 , THR A:378 , VAL A:455 , ASN A:484 , TYR A:573 , GLU A:672 , ALA A:673 , SER A:674 , GLY A:675 , HOH A:2155 , HOH A:2156 , HOH A:2175 , HOH A:2361 , HOH A:2391	BINDING SITE FOR RESIDUE NBG A 861
2	AC2	SOFTWARE	TYR A:90 , GLY A:134 , GLY A:135 , LYS A:568 , LYS A:574 , TYR A:648 , ARG A:649 , VAL A:650 , GLY A:675 , THR A:676 , GLY A:677 , LYS A:680 , HOH A:2115 , HOH A:2123 , HOH A:2128 , HOH A:2187 , HOH A:2500	BINDING SITE FOR RESIDUE PLP A 860
3	AC3	SOFTWARE	TYR B:90 , GLY B:134 , GLY B:135 , TRP B:491 , LYS B:568 , LYS B:574 , TYR B:648 , ARG B:649 , VAL B:650 , GLY B:675 , THR B:676 , GLY B:677 , LYS B:680 , HOH B:2026 , HOH B:2060 , HOH B:2182 , HOH B:2233 , HOH B:2235 , HOH B:2503	BINDING SITE FOR RESIDUE PLP B 860
4	AC4	SOFTWARE	ARG A:60 , LEU A:63 , TRP A:67 , PRO A:188 , GLU A:190 , LYS A:191 , SER A:192 , HOH A:2034 , HOH A:2210 , HOH A:2379 , HOH A:2481 , THR B:38 , VAL B:40 , PHE B:53 , HIS B:57 , TYR B:185 , PRO B:188	BINDING SITE FOR RESIDUE 700 A 862
5	AC5	SOFTWARE	ASN A:282 , ASN A:284 , PHE A:285 , LEU A:380 , GLU A:382 , HIS A:571 , TYR A:573 , ALA A:610 , GLY A:612 , TYR A:613 , ARG A:770 , PHE A:771 , HOH A:2001 , HOH A:2002 , HOH A:2193	BINDING SITE FOR RESIDUE RBF A 859
6	AC6	SOFTWARE	VAL A:40 , TRP B:67 , GLN B:71 , ARG B:193 , HOH B:2172 , HOH B:2331	BINDING SITE FOR RESIDUE MRD B 902

(no "SS Bond" information available for 1L5R)

(no "Cis Peptide Bond" information available for 1L5R)

Asymmetric Unit (8, 16)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_007907	V	222	I	PYGL_HUMAN	Polymorphism	946616	A/B	V	221	I
2	UniProt	VAR_013095	V	231	E	PYGL_HUMAN	Polymorphism	1042195	A/B	V	230	E
3	UniProt	VAR_007908	N	339	S	PYGL_HUMAN	Disease (GSD6)	113993976	A/B	N	338	S
4	UniProt	VAR_007909	N	377	K	PYGL_HUMAN	Disease (GSD6)	113993977	A/B	N	376	K
5	UniProt	VAR_034425	R	425	P	PYGL_HUMAN	Polymorphism	2228499	A/B	R	424	P
6	UniProt	VAR_034426	V	698	G	PYGL_HUMAN	Polymorphism	35831273	A/B	V	697	G
7	UniProt	VAR_013096	R	715	S	PYGL_HUMAN	Polymorphism	1042210	A/B	R	714	S
8	UniProt	VAR_034427	I	806	L	PYGL_HUMAN	Polymorphism	34313873	A/B	I	805	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (8, 32)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_007907	V	222	I	PYGL_HUMAN	Polymorphism	946616	A/B	V	221	I
2	UniProt	VAR_013095	V	231	E	PYGL_HUMAN	Polymorphism	1042195	A/B	V	230	E
3	UniProt	VAR_007908	N	339	S	PYGL_HUMAN	Disease (GSD6)	113993976	A/B	N	338	S
4	UniProt	VAR_007909	N	377	K	PYGL_HUMAN	Disease (GSD6)	113993977	A/B	N	376	K
5	UniProt	VAR_034425	R	425	P	PYGL_HUMAN	Polymorphism	2228499	A/B	R	424	P
6	UniProt	VAR_034426	V	698	G	PYGL_HUMAN	Polymorphism	35831273	A/B	V	697	G
7	UniProt	VAR_013096	R	715	S	PYGL_HUMAN	Polymorphism	1042210	A/B	R	714	S
8	UniProt	VAR_034427	I	806	L	PYGL_HUMAN	Polymorphism	34313873	A/B	I	805	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PHOSPHORYLASE	PS00102	Phosphorylase pyridoxal-phosphate attachment site.	PYGL_HUMAN	673-685	2	A:672-684 B:672-684

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PHOSPHORYLASE	PS00102	Phosphorylase pyridoxal-phosphate attachment site.	PYGL_HUMAN	673-685	4	A:672-684 B:672-684

Asymmetric Unit (20, 40)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000216392	1a	ENSE00001368552	chr14:51411234-51410879	356	PYGL_HUMAN	1-81	81	2	A:22-80 B:22-80	59 59
1.2	ENST00000216392	2	ENSE00000657195	chr14:51404555-51404454	102	PYGL_HUMAN	82-115	34	2	A:81-114 B:81-114	34 34
1.3b	ENST00000216392	3b	ENSE00000657194	chr14:51401903-51401825	79	PYGL_HUMAN	116-142	27	2	A:115-141 B:115-141	27 27
1.4a	ENST00000216392	4a	ENSE00000657193	chr14:51398494-51398391	104	PYGL_HUMAN	142-176	35	2	A:141-175 B:141-175	35 35
1.5a	ENST00000216392	5a	ENSE00000657192	chr14:51390818-51390687	132	PYGL_HUMAN	177-220	44	2	A:176-219 B:176-219	44 44
1.6	ENST00000216392	6	ENSE00000657191	chr14:51387785-51387674	112	PYGL_HUMAN	221-258	38	2	A:220-250 B:220-250	31 31
1.7	ENST00000216392	7	ENSE00001647495	chr14:51387341-51387259	83	PYGL_HUMAN	258-285	28	2	A:261-284 B:261-284	24 24
1.8a	ENST00000216392	8a	ENSE00001507082	chr14:51383823-51383680	144	PYGL_HUMAN	286-333	48	2	A:285-332 (gaps) B:285-332 (gaps)	48 48
1.9	ENST00000216392	9	ENSE00001800310	chr14:51383452-51383360	93	PYGL_HUMAN	334-364	31	2	A:333-363 B:333-363	31 31
1.10a	ENST00000216392	10a	ENSE00000657186	chr14:51382689-51382543	147	PYGL_HUMAN	365-413	49	2	A:364-412 B:364-412	49 49
1.11	ENST00000216392	11	ENSE00000657184	chr14:51382217-51382054	164	PYGL_HUMAN	414-468	55	2	A:413-467 B:413-467	55 55
1.12	ENST00000216392	12	ENSE00000657182	chr14:51381533-51381419	115	PYGL_HUMAN	468-506	39	2	A:467-505 B:467-505	39 39
1.13	ENST00000216392	13	ENSE00000657181	chr14:51379848-51379747	102	PYGL_HUMAN	507-540	34	2	A:506-539 B:506-539	34 34
1.14a	ENST00000216392	14a	ENSE00000657180	chr14:51379021-51378874	148	PYGL_HUMAN	541-590	50	2	A:540-589 B:540-589	50 50
1.15a	ENST00000216392	15a	ENSE00000657178	chr14:51378754-51378696	59	PYGL_HUMAN	590-609	20	2	A:589-608 B:589-608	20 20
1.16b	ENST00000216392	16b	ENSE00000657176	chr14:51378589-51378448	142	PYGL_HUMAN	610-657	48	2	A:609-656 B:609-656	48 48
1.17b	ENST00000216392	17b	ENSE00001681548	chr14:51376820-51376613	208	PYGL_HUMAN	657-726	70	2	A:656-725 B:656-725	70 70
1.18	ENST00000216392	18	ENSE00000657174	chr14:51375673-51375539	135	PYGL_HUMAN	726-771	46	2	A:725-770 B:725-770	46 46
1.19a	ENST00000216392	19a	ENSE00000657173	chr14:51375055-51374989	67	PYGL_HUMAN	771-793	23	2	A:770-792 B:770-792	23 23
1.20a	ENST00000216392	20a	ENSE00002201324	chr14:51372274-51371939	336	PYGL_HUMAN	794-847	54	2	A:793-829 B:793-830	37 38

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:790
 aligned with PYGL_HUMAN | P06737 from UniProtKB/Swiss-Prot  Length:847

    Alignment length:808
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822        
           PYGL_HUMAN    23 ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEP 830
               SCOP domains d1l5ra_ A: Glycogen phosphorylase                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains -1l5rA01 A:23-485,A:813-827 Glycogen Phosphorylase B;                                                                                                                                                                                                                                                                                                                                                                                                                           1l5rA02 A:486-812 Glycogen Phosphorylase B;                                                                                                                                                                                                                                                                                            1l5rA01        -- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee...eeee.hhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhh..eee..hhhhhhhhhhhhhhhhh...eeeeee.......eeeee..eeeee............ee.hhhheeeee..eeee....eeee..eeeeeeeeeeeee......eeeeeeeeee...----------hhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhh..--------hhhhhhhheeeeee.....hhhhhhhhhhhhh...hhhhhhhhhhhheeee....hhhhh.eeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.ee.....eeehhhhhhhhh.eeee.hhhhhhhhhhh.hhhhhhhh...eee..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeee.......hhhhhhhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh...hhh.eeeee....hhhhhhhhhhhh.eeee..........hhhhhhhhh..eeee....hhhhhhhhhhhhhhee...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I--------E-----------------------------------------------------------------------------------------------------------S-------------------------------------K-----------------------------------------------P--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------G----------------S------------------------------------------------------------------------------------------L------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOSPHORYLASE------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:22-80 UniProt: 1-81 [INCOMPLETE]         Exon 1.2  PDB: A:81-114           Exon 1.3b  PDB: A:115-141  ----------------------------------Exon 1.5a  PDB: A:176-219 UniProt: 177-220  Exon 1.6  PDB: A:220-250 [INCOMPLETE] ---------------------------Exon 1.8a  PDB: A:285-332 (gaps)                Exon 1.9  PDB: A:333-363       Exon 1.10a  PDB: A:364-412 UniProt: 365-413      Exon 1.11  PDB: A:413-467 UniProt: 414-468             --------------------------------------Exon 1.13  PDB: A:506-539         Exon 1.14a  PDB: A:540-589 UniProt: 541-590       -------------------Exon 1.16b  PDB: A:609-656 UniProt: 610-657     --------------------------------------------------------------------Exon 1.18  PDB: A:725-770 UniProt: 726-771    ----------------------Exon 1.20a  PDB: A:793-829            Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: A:141-175          ---------------------------------------------------------------------------------Exon 1.7  PDB: A:261-284    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: A:467-505              -----------------------------------------------------------------------------------Exon 1.15a          -----------------------------------------------Exon 1.17b  PDB: A:656-725 UniProt: 657-726                           --------------------------------------------Exon 1.19a             ------------------------------------- Transcript 1 (2)
                 1l5r A  22 ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPN----------DYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKF--------VFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEP 829
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241        |-       261       271       281       291       301       311    |    -   |   331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821        
                                                                                                                                                                                                                                                              250        261                                                    316      325

Chain B from PDB  Type:PROTEIN  Length:791
 aligned with PYGL_HUMAN | P06737 from UniProtKB/Swiss-Prot  Length:847

    Alignment length:809
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822         
           PYGL_HUMAN    23 ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS 831
               SCOP domains d1l5rb_ B: Glycogen phosphorylase                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains -1l5rB01 B:23-485,B:813-828 Glycogen Phosphorylase B;                                                                                                                                                                                                                                                                                                                                                                                                                           1l5rB02 B:486-812 Glycogen Phosphorylase B;                                                                                                                                                                                                                                                                                            1l5rB01         -- CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------Phosphorylase-1l5rB01 B:111-829                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                - Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------Phosphorylase-1l5rB02 B:111-829                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                - Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..eeeee...eeee.hhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhh..eee..hhhhhhhhhhhhhhhhh...eeeeee.......eeeee..eeeee............ee.hhhheeeee..eeee....eeee..eeeeeeeeeeeee......eeeeeeeeee...----------hhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhh..--------...hhhhheeeeee.....hhhhhhhhhhhhh...hhhhhhhhhhhheeee....hhhhh.eeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.ee.....eeehhhhhhhhh.eeee.hhhhhhhhhhh.hhhhhhhh...eee..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeee.......hhhhhhhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh...hhh.eeeee....hhhhhhhhhhhh.eeee..........hhhhhhhhh..eeee....hhhhhhhhhhhhhhee...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I--------E-----------------------------------------------------------------------------------------------------------S-------------------------------------K-----------------------------------------------P--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------G----------------S------------------------------------------------------------------------------------------L------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOSPHORYLASE-------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: B:22-80 UniProt: 1-81 [INCOMPLETE]         Exon 1.2  PDB: B:81-114           Exon 1.3b  PDB: B:115-141  ----------------------------------Exon 1.5a  PDB: B:176-219 UniProt: 177-220  Exon 1.6  PDB: B:220-250 [INCOMPLETE] ---------------------------Exon 1.8a  PDB: B:285-332 (gaps)                Exon 1.9  PDB: B:333-363       Exon 1.10a  PDB: B:364-412 UniProt: 365-413      Exon 1.11  PDB: B:413-467 UniProt: 414-468             --------------------------------------Exon 1.13  PDB: B:506-539         Exon 1.14a  PDB: B:540-589 UniProt: 541-590       -------------------Exon 1.16b  PDB: B:609-656 UniProt: 610-657     --------------------------------------------------------------------Exon 1.18  PDB: B:725-770 UniProt: 726-771    ----------------------Exon 1.20a  PDB: B:793-830             Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: B:141-175          ---------------------------------------------------------------------------------Exon 1.7  PDB: B:261-284    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: B:467-505              -----------------------------------------------------------------------------------Exon 1.15a          -----------------------------------------------Exon 1.17b  PDB: B:656-725 UniProt: 657-726                           --------------------------------------------Exon 1.19a             -------------------------------------- Transcript 1 (2)
                 1l5r B  22 ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPN----------DYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKF--------VFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS 830
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241        |-       261       271       281       291       301       311    |    -   |   331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821         
                                                                                                                                                                                                                                                              250        261                                                    316      325

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: UDP-Glycosyltransferase/glycogen phosphorylase (296)

Superfamily: UDP-Glycosyltransferase/glycogen phosphorylase (296)

Family: Oligosaccharide phosphorylase (199)

Protein domain: Glycogen phosphorylase (86)

Human (Homo sapiens) [TaxId: 9606] (16)

1a	d1l5ra_	A:
1b	d1l5rb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Glycogen Phosphorylase B; (202)

Human (Homo sapiens) (16)

1a	1l5rA02	A:486-812
1b	1l5rB02	B:486-812
1c	1l5rA01	A:23-485,A:813-827
1d	1l5rB01	B:23-485,B:813-828

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: GT-B (132)

Family: Phosphorylase (83)

Homo sapiens (Human) (8)

1a	Phosphorylase-1l5rB01	B:111-829
1b	Phosphorylase-1l5rB02	B:111-829

Asymmetric Unit(hide GO term definitions)

Chain A,B (PYGL_HUMAN | P06737)

molecular function
	GO:0016208	AMP binding	Interacting selectively and non-covalently with AMP, adenosine monophosphate.
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0032052	bile acid binding	Interacting selectively and non-covalently with bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0008144	drug binding	Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
	GO:0005536	glucose binding	Interacting selectively and non-covalently with the D- or L-enantiomer of glucose.
	GO:0008184	glycogen phosphorylase activity	Catalysis of the reaction: glycogen + phosphate = maltodextrin + alpha-D-glucose 1-phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0004645	phosphorylase activity	Catalysis of the reaction: 1,4-alpha-D-glucosyl(n) + phosphate = 1,4-alpha-D-glucosyl(n-1) + alpha-D-glucose 1-phosphate. The name should be qualified in each instance by adding the name of the natural substrate, e.g. maltodextrin phosphorylase, starch phosphorylase, glycogen phosphorylase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0002060	purine nucleobase binding	Interacting selectively and non-covalently with a purine nucleobase, an organic nitrogenous base with a purine skeleton.
	GO:0030170	pyridoxal phosphate binding	Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
	GO:0019842	vitamin binding	Interacting selectively and non-covalently with a vitamin, one of a number of unrelated organic substances that occur in many foods in small amounts and that are necessary in trace amounts for the normal metabolic functioning of the body.
biological process
	GO:0006015	5-phosphoribose 1-diphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of 5-phosphoribose 1-diphosphate, also known as 5-phosphoribosyl-1-pyrophosphate.
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0042593	glucose homeostasis	Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
	GO:0005980	glycogen catabolic process	The chemical reactions and pathways resulting in the breakdown of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
	GO:0005977	glycogen metabolic process	The chemical reactions and pathways involving glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues in alpha-(1->4) glycosidic linkage, joined together by alpha-(1->6) glycosidic linkages.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0070266	necroptotic process	A programmed necrotic cell death process which begins when a cell receives a signal (e.g. a ligand binding to a death receptor or to a Toll-like receptor), and proceeds through a series of biochemical events (signaling pathways), characterized by activation of receptor-interacting serine/threonine-protein kinase 1 and/or 3 (RIPK1/3, also called RIP1/3) and by critical dependence on mixed lineage kinase domain-like (MLKL), and which typically lead to common morphological features of necrotic cell death. The process ends when the cell has died. The process is divided into a signaling phase, and an execution phase, which is triggered by the former.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		700	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MRD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NBG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PLP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		RBF	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1l5r)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1l5r
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PYGL_HUMAN \| P06737
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.4.1.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	232700
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PYGL_HUMAN \| P06737
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1l5q	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH CAFFEINE, N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE, AND CP-403700
1l5s	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH URIC ACID, N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE, AND CP-403,700
1l7x	HUMAN LIVER GLYCOGEN PHOSPHORYLASE B COMPLEXED WITH CAFFEINE, N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE, AND CP-403, 700

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (8, 16)

PROSITE Motifs (1, 2)

Exons (20, 40)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 4)

Pfam Domains (1, 2)

Gene Ontology (28, 28)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File