|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1I5F) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1I5F) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1I5F) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1I5F) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:66 aligned with CSPB_BACCL | P41016 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 CSPB_BACCL 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 SCOP domains d1i5fa_ A: Major cold shock protein SCOP domains CATH domains 1i5fA00 A:1-66 Nucleic acid-binding proteins CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE --------------COLD_SHOCK --------------------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 1i5f A 1 MQEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:66 aligned with CSPB_BACCL | P41016 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 CSPB_BACCL 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 SCOP domains d1i5fb_ B: Major cold shock protein SCOP domains CATH domains 1i5fB00 B:1-66 Nucleic acid-binding proteins CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE --------------COLD_SHOCK --------------------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 1i5f B 1 MQEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1I5F) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CSPB_BACCL | P41016)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|