|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1HZA) |
(no "Site" information available for 1HZA) |
(no "SS Bond" information available for 1HZA) |
(no "Cis Peptide Bond" information available for 1HZA) |
(no "SAP(SNP)/Variant" information available for 1HZA) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 1HZA) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:67 aligned with CSPB_BACCL | P41016 from UniProtKB/Swiss-Prot Length:66 Alignment length:67 66 10 20 30 40 50 60 | CSPB_BACCL 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL- - SCOP domains d1hzaa_ A: Major cold shock protein SCOP domains CATH domains 1hzaA00 A:1-67 Nucleic acid-binding proteins CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------COLD_SHOCK ---------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1hza A 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA 67 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:67 aligned with CSPB_BACCL | P41016 from UniProtKB/Swiss-Prot Length:66 Alignment length:67 66 10 20 30 40 50 60 | CSPB_BACCL 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL- - SCOP domains d1hzab_ B: Major cold shock protein SCOP domains CATH domains 1hzaB00 B:1-67 Nucleic acid-binding proteins CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------COLD_SHOCK ---------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1hza B 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA 67 10 20 30 40 50 60
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1HZA) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CSPB_BACCL | P41016)
|
|
|
|
|
|
|