1HYN - JenaLib

Asymmetric Unit (10, 40)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000799	K	56	E	B3AT_HUMAN	Polymorphism	5036	P/Q/R/S	K	56	E
02	UniProt	VAR_039290	E	68	K	B3AT_HUMAN	Polymorphism	13306787	P/Q/R/S	E	68	K
03	UniProt	VAR_058036	E	72	D	B3AT_HUMAN	Polymorphism	13306788	P/Q/R/S	E	72	D
04	UniProt	VAR_039291	L	73	M	B3AT_HUMAN	Polymorphism	781490287	P/Q/R/S	L	73	M
05	UniProt	VAR_013784	E	90	K	B3AT_HUMAN	Disease (SPH4)	28929480	P/Q/R/S	E	90	K
06	UniProt	VAR_014613	R	112	S	B3AT_HUMAN	Polymorphism	5037	P/Q/R/S	R	112	S
07	UniProt	VAR_013785	G	130	R	B3AT_HUMAN	Disease (SPH4)	121912749	P/Q/R/S	G	130	R
08	UniProt	VAR_013786	P	147	S	B3AT_HUMAN	Disease (SPH4)	---	P/Q/R/S	P	147	S
09	UniProt	VAR_013787	A	285	D	B3AT_HUMAN	Disease (SPH4)	---	P/Q/R/S	A	285	D
10	UniProt	VAR_000800	P	327	R	B3AT_HUMAN	Disease (SPH4)	28931583	P/Q/R/S	P	327	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (10, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000799	K	56	E	B3AT_HUMAN	Polymorphism	5036	P/Q	K	56	E
02	UniProt	VAR_039290	E	68	K	B3AT_HUMAN	Polymorphism	13306787	P/Q	E	68	K
03	UniProt	VAR_058036	E	72	D	B3AT_HUMAN	Polymorphism	13306788	P/Q	E	72	D
04	UniProt	VAR_039291	L	73	M	B3AT_HUMAN	Polymorphism	781490287	P/Q	L	73	M
05	UniProt	VAR_013784	E	90	K	B3AT_HUMAN	Disease (SPH4)	28929480	P/Q	E	90	K
06	UniProt	VAR_014613	R	112	S	B3AT_HUMAN	Polymorphism	5037	P/Q	R	112	S
07	UniProt	VAR_013785	G	130	R	B3AT_HUMAN	Disease (SPH4)	121912749	P/Q	G	130	R
08	UniProt	VAR_013786	P	147	S	B3AT_HUMAN	Disease (SPH4)	---	P/Q	P	147	S
09	UniProt	VAR_013787	A	285	D	B3AT_HUMAN	Disease (SPH4)	---	P/Q	A	285	D
10	UniProt	VAR_000800	P	327	R	B3AT_HUMAN	Disease (SPH4)	28931583	P/Q	P	327	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (10, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000799	K	56	E	B3AT_HUMAN	Polymorphism	5036	R/S	K	56	E
02	UniProt	VAR_039290	E	68	K	B3AT_HUMAN	Polymorphism	13306787	R/S	E	68	K
03	UniProt	VAR_058036	E	72	D	B3AT_HUMAN	Polymorphism	13306788	R/S	E	72	D
04	UniProt	VAR_039291	L	73	M	B3AT_HUMAN	Polymorphism	781490287	R/S	L	73	M
05	UniProt	VAR_013784	E	90	K	B3AT_HUMAN	Disease (SPH4)	28929480	R/S	E	90	K
06	UniProt	VAR_014613	R	112	S	B3AT_HUMAN	Polymorphism	5037	R/S	R	112	S
07	UniProt	VAR_013785	G	130	R	B3AT_HUMAN	Disease (SPH4)	121912749	R/S	G	130	R
08	UniProt	VAR_013786	P	147	S	B3AT_HUMAN	Disease (SPH4)	---	R/S	P	147	S
09	UniProt	VAR_013787	A	285	D	B3AT_HUMAN	Disease (SPH4)	---	R/S	A	285	D
10	UniProt	VAR_000800	P	327	R	B3AT_HUMAN	Disease (SPH4)	28931583	R/S	P	327	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (10, 80)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000799	K	56	E	B3AT_HUMAN	Polymorphism	5036	P/Q/R/S	K	56	E
02	UniProt	VAR_039290	E	68	K	B3AT_HUMAN	Polymorphism	13306787	P/Q/R/S	E	68	K
03	UniProt	VAR_058036	E	72	D	B3AT_HUMAN	Polymorphism	13306788	P/Q/R/S	E	72	D
04	UniProt	VAR_039291	L	73	M	B3AT_HUMAN	Polymorphism	781490287	P/Q/R/S	L	73	M
05	UniProt	VAR_013784	E	90	K	B3AT_HUMAN	Disease (SPH4)	28929480	P/Q/R/S	E	90	K
06	UniProt	VAR_014613	R	112	S	B3AT_HUMAN	Polymorphism	5037	P/Q/R/S	R	112	S
07	UniProt	VAR_013785	G	130	R	B3AT_HUMAN	Disease (SPH4)	121912749	P/Q/R/S	G	130	R
08	UniProt	VAR_013786	P	147	S	B3AT_HUMAN	Disease (SPH4)	---	P/Q/R/S	P	147	S
09	UniProt	VAR_013787	A	285	D	B3AT_HUMAN	Disease (SPH4)	---	P/Q/R/S	A	285	D
10	UniProt	VAR_000800	P	327	R	B3AT_HUMAN	Disease (SPH4)	28931583	P/Q/R/S	P	327	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (7, 28)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain P from PDB  Type:PROTEIN  Length:293
 aligned with B3AT_HUMAN | P02730 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:293
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345   
           B3AT_HUMAN    56 KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ 348
               SCOP domains d1hynp_ P: Erythrocite membrane Band 3                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1hynP00 P:56-348 Band 3 anion transport protein                                                                                                                                                                                                                                                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee.....eeeeeeeeee..eee...............hhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..eehhhhhhhhh.eee.ee.....ee........hhhhhhhh.........hhhhhhhhhh.....eeeeeeee.......eeeeeeeeeee..........eeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) E-----------K---DM----------------K---------------------S-----------------R----------------S-----------------------------------------------------------------------------------------------------------------------------------------D-----------------------------------------R--------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1Exon 1.5b  PDB: P:57-117 UniProt: 57-117                     --------------------------------------------Exon 1.7b  PDB: P:162-203 UniProt: 162-203Exon 1.8  PDB: P:204-232     ------------------------------------------------------------Exon 1.10  PDB: P:293-348 UniProt: 293-363 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.6  PDB: P:117-162 UniProt: 117-162     ---------------------------------------------------------------------Exon 1.9  PDB: P:232-292 UniProt: 232-292                    -------------------------------------------------------- Transcript 1 (2)
                 1hyn P  56 KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ 348
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345

Chain Q from PDB  Type:PROTEIN  Length:302
 aligned with B3AT_HUMAN | P02730 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:302
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354  
           B3AT_HUMAN    55 HKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDS 356
               SCOP domains d1hynq_ Q: Erythrocite membrane Band 3                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains 1hynQ00 Q:55-356 Band 3 anion transport protein                                                                                                                                                                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee.....eeeeeeeee...eee...............hhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..eehhhhhhhhh.eee.ee.....ee........hhhhhhh...........hhhhhhhhh.....eeeeeeee.......eeeeeeeeeee..........eeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.eee.....hhhhhhh..hhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -E-----------K---DM----------------K---------------------S-----------------R----------------S-----------------------------------------------------------------------------------------------------------------------------------------D-----------------------------------------R----------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.Exon 1.5b  PDB: Q:57-117 UniProt: 57-117                     --------------------------------------------Exon 1.7b  PDB: Q:162-203 UniProt: 162-203Exon 1.8  PDB: Q:204-232     ------------------------------------------------------------Exon 1.10  PDB: Q:293-356 UniProt: 293-363 [INCOMPLETE]          Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------Exon 1.6  PDB: Q:117-162 UniProt: 117-162     ---------------------------------------------------------------------Exon 1.9  PDB: Q:232-292 UniProt: 232-292                    ---------------------------------------------------------------- Transcript 1 (2)
                 1hyn Q  55 HKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDS 356
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354

Chain R from PDB  Type:PROTEIN  Length:300
 aligned with B3AT_HUMAN | P02730 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:300
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355
           B3AT_HUMAN    56 KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPD 355
               SCOP domains d1hynr_ R: Erythrocite membrane Band 3                                                                                                                                                                                                                                                                       SCOP domains
               CATH domains 1hynR00 R:56-355 Band 3 anion transport protein                                                                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeeeee.....eeeeeeeee...eee..............eehhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhh......hhhhhhhhhh..eehhhhhhhh..eee.ee.....ee........hhhhhhhh.........hhhhhhhhhh.....eeeeeeeee......eeeeeeeeeee..........eeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.eee.....hhhhhh...hhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) E-----------K---DM----------------K---------------------S-----------------R----------------S-----------------------------------------------------------------------------------------------------------------------------------------D-----------------------------------------R---------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1Exon 1.5b  PDB: R:57-117 UniProt: 57-117                     --------------------------------------------Exon 1.7b  PDB: R:162-203 UniProt: 162-203Exon 1.8  PDB: R:204-232     ------------------------------------------------------------Exon 1.10  PDB: R:293-355 UniProt: 293-363 [INCOMPLETE]         Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.6  PDB: R:117-162 UniProt: 117-162     ---------------------------------------------------------------------Exon 1.9  PDB: R:232-292 UniProt: 232-292                    --------------------------------------------------------------- Transcript 1 (2)
                 1hyn R  56 KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPD 355
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355

Chain S from PDB  Type:PROTEIN  Length:293
 aligned with B3AT_HUMAN | P02730 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:293
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345   
           B3AT_HUMAN    56 KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ 348
               SCOP domains d1hyns_ S: Erythrocite membrane Band 3                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1hynS00 S:56-348 Band 3 anion transport protein                                                                                                                                                                                                                                                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee.....eeeeeeeeee..eee...............hhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..eehhhhhhhhh.eee.ee.....ee........hhhhhhhh.........hhhhhhhhhh.....eeeeeeee.......eeeeeeeeeee..........eeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) E-----------K---DM----------------K---------------------S-----------------R----------------S-----------------------------------------------------------------------------------------------------------------------------------------D-----------------------------------------R--------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1Exon 1.5b  PDB: S:57-117 UniProt: 57-117                     --------------------------------------------Exon 1.7b  PDB: S:162-203 UniProt: 162-203Exon 1.8  PDB: S:204-232     ------------------------------------------------------------Exon 1.10  PDB: S:293-348 UniProt: 293-363 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.6  PDB: S:117-162 UniProt: 117-162     ---------------------------------------------------------------------Exon 1.9  PDB: S:232-292 UniProt: 232-292                    -------------------------------------------------------- Transcript 1 (2)
                 1hyn S  56 KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ 348
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (30, 30)

Asymmetric Unit(hide GO term definitions)

Chain P,Q,R,S (B3AT_HUMAN | P02730)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0008509	anion transmembrane transporter activity	Enables the transfer of a negatively charged ion from one side of a membrane to the other.
	GO:0015301	anion:anion antiporter activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: anion A(out) + anion B(in) = anion A(in) + anion B(out).
	GO:0030506	ankyrin binding	Interacting selectively and non-covalently with ankyrin, a 200 kDa cytoskeletal protein that attaches other cytoskeletal proteins to integral membrane proteins.
	GO:0015106	bicarbonate transmembrane transporter activity	Enables the transfer of bicarbonate from one side of a membrane to the other. Bicarbonate is the hydrogencarbonate ion, HCO3-.
	GO:0015108	chloride transmembrane transporter activity	Enables the transfer of chloride ions from one side of a membrane to the other.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0005452	inorganic anion exchanger activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: inorganic anion A(out) + inorganic anion B(in) = inorganic anion A(in) + inorganic anion B(out).
	GO:0008022	protein C-terminus binding	Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0043495	protein anchor	Interacting selectively and non-covalently with both a protein or protein complex and a membrane, in order to maintain the localization of the protein at a specific membrane location.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0006820	anion transport	The directed movement of anions, atoms or small molecules with a net negative charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015701	bicarbonate transport	The directed movement of bicarbonate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006873	cellular ion homeostasis	Any process involved in the maintenance of an internal steady state of ions at the level of a cell.
	GO:1902476	chloride transmembrane transport	The directed movement of chloride across a membrane.
	GO:0006821	chloride transport	The directed movement of chloride into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051453	regulation of intracellular pH	Any process that modulates the internal pH of a cell, measured by the concentration of the hydrogen ion.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0030863	cortical cytoskeleton	The portion of the cytoskeleton that lies just beneath the plasma membrane.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 40)

PROSITE Motifs (0, 0)

Exons (7, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (30, 30)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File