Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  A LOW ENERGY STRUCTURE FOR THE FINAL CYTOPLASMIC LOOP OF BAND 3, NMR, MINIMIZED AVERAGE STRUCTURE
 
Authors :  D. Askin, G. B. Bloomberg, E. J. Chambers, M. J. A. Tanner
Date :  16 Jun 98  (Deposition) - 04 Nov 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Membrane Protein, Cytoplasmic Loop, Anion Exchange Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Askin, G. B. Bloomberg, E. J. Chambers, M. J. Tanner
Nmr Solution Structure Of A Cytoplasmic Surface Loop Of The Human Red Cell Anion Transporter, Band 3.
Biochemistry V. 37 11670 1998
PubMed-ID: 9709005  |  Reference-DOI: 10.1021/BI973158D
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BAND 3
    ChainsA
    EngineeredYES
    FragmentFINAL CYTOPLASMIC LOOP
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BH7)

(-) Sites  (0, 0)

(no "Site" information available for 1BH7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BH7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BH7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 4)

NMR Structure (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_013810R808CB3AT_HUMANDisease (SPH4)  ---AR14C
2UniProtVAR_013811R808HB3AT_HUMANDisease (SPH4)866727908AR14H
3UniProtVAR_014618R832HB3AT_HUMANPolymorphism5025AR38H
4UniProtVAR_013812H834PB3AT_HUMANDisease (SPH4)  ---AH40P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BH7)

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002624181aENSE00001349736chr17:42345509-4234542288B3AT_HUMAN-00--
1.2aENST000002624182aENSE00002150487chr17:42340302-4234022083B3AT_HUMAN1-550--
1.2cENST000002624182cENSE00000732338chr17:42340094-4234000491B3AT_HUMAN6-36310--
1.4ENST000002624184ENSE00001627271chr17:42339004-4233894362B3AT_HUMAN36-56210--
1.5bENST000002624185bENSE00001758791chr17:42338183-42338003181B3AT_HUMAN57-117610--
1.6ENST000002624186ENSE00002192207chr17:42337907-42337772136B3AT_HUMAN117-162460--
1.7bENST000002624187bENSE00000732352chr17:42337300-42337177124B3AT_HUMAN162-203420--
1.8ENST000002624188ENSE00001059612chr17:42336949-4233686585B3AT_HUMAN204-232290--
1.9ENST000002624189ENSE00000390701chr17:42336712-42336531182B3AT_HUMAN232-292610--
1.10ENST0000026241810ENSE00000390702chr17:42335991-42335781211B3AT_HUMAN293-363710--
1.11bENST0000026241811bENSE00000390703chr17:42335548-42335354195B3AT_HUMAN363-428660--
1.12ENST0000026241812ENSE00001633466chr17:42335175-42335027149B3AT_HUMAN428-477500--
1.13aENST0000026241813aENSE00000390705chr17:42334912-42334718195B3AT_HUMAN478-542650--
1.14ENST0000026241814ENSE00000732375chr17:42333214-42333041174B3AT_HUMAN543-600580--
1.15aENST0000026241815aENSE00000390707chr17:42332664-4233257590B3AT_HUMAN601-630300--
1.16bENST0000026241816bENSE00000732380chr17:42332030-42331864167B3AT_HUMAN631-686560--
1.17aENST0000026241817aENSE00000390709chr17:42330739-42330486254B3AT_HUMAN686-771860--
1.18bENST0000026241818bENSE00000732382chr17:42328956-42328787170B3AT_HUMAN771-827571A:9-33 (gaps)25
1.19ENST0000026241819ENSE00000390711chr17:42328700-42328527174B3AT_HUMAN828-885581A:34-418
1.20ENST0000026241820ENSE00000854253chr17:42327906-423257532154B3AT_HUMAN886-911260--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:31
 aligned with B3AT_HUMAN | P02730 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:33
                                   812       822       832   
           B3AT_HUMAN   803 IQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHL 835
               SCOP domains d1bh7a_  A: Band 3                SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ........-..........-......hhhhh.. Sec.struct. author
             SAPs(SNPs) (1) -----C-----------------------H-P- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----H--------------------------- SAPs(SNPs) (2)
                    PROSITE --------------------------------- PROSITE
               Transcript 1 Exon 1.18b [INCOMPLETE]  1.19     Transcript 1
                 1bh7 A   9 IQLFDRIL-LFKPPKYHPD-PYVKRVKTWRMHL  41
                                   |18        |-|       38   
                                  16 |       27 |            
                                    18         29            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1BH7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BH7)

(-) Gene Ontology  (30, 30)

NMR Structure(hide GO term definitions)
Chain A   (B3AT_HUMAN | P02730)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0008509    anion transmembrane transporter activity    Enables the transfer of a negatively charged ion from one side of a membrane to the other.
    GO:0015301    anion:anion antiporter activity    Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: anion A(out) + anion B(in) = anion A(in) + anion B(out).
    GO:0030506    ankyrin binding    Interacting selectively and non-covalently with ankyrin, a 200 kDa cytoskeletal protein that attaches other cytoskeletal proteins to integral membrane proteins.
    GO:0015106    bicarbonate transmembrane transporter activity    Enables the transfer of bicarbonate from one side of a membrane to the other. Bicarbonate is the hydrogencarbonate ion, HCO3-.
    GO:0015108    chloride transmembrane transporter activity    Enables the transfer of chloride ions from one side of a membrane to the other.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0005452    inorganic anion exchanger activity    Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: inorganic anion A(out) + inorganic anion B(in) = inorganic anion A(in) + inorganic anion B(out).
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0043495    protein anchor    Interacting selectively and non-covalently with both a protein or protein complex and a membrane, in order to maintain the localization of the protein at a specific membrane location.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0006820    anion transport    The directed movement of anions, atoms or small molecules with a net negative charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0015701    bicarbonate transport    The directed movement of bicarbonate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006873    cellular ion homeostasis    Any process involved in the maintenance of an internal steady state of ions at the level of a cell.
    GO:1902476    chloride transmembrane transport    The directed movement of chloride across a membrane.
    GO:0006821    chloride transport    The directed movement of chloride into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0051453    regulation of intracellular pH    Any process that modulates the internal pH of a cell, measured by the concentration of the hydrogen ion.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0030018    Z disc    Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0030863    cortical cytoskeleton    The portion of the cytoskeleton that lies just beneath the plasma membrane.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bh7)
 
  Sites
(no "Sites" information available for 1bh7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bh7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Prepi
  C alpha wire
  C alpha wire, labeling , sequence
  ribbon, secondary structure, sequence

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bh7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B3AT_HUMAN | P02730
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  612653
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  B3AT_HUMAN | P02730
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        B3AT_HUMAN | P027301bnx 1btq 1btr 1bts 1btt 1bzk 1hyn 2bta 2btb 3btb 4ky9 4yzf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BH7)