1GZ6 - JenaLib

Asymmetric Unit (12, 48)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000021646	1	ENSRNOE00000351511	chr18:45157435-45157541	107	DHB4_RAT	1-20	20	4	A:3-20 B:3-20 C:4-20 D:3-20	18 18 17 18
1.2	ENSRNOT00000021646	2	ENSRNOE00000254859	chr18:45159340-45159393	54	DHB4_RAT	20-38	19	4	A:20-38 B:20-38 C:20-38 D:20-38	19 19 19 19
1.3	ENSRNOT00000021646	3	ENSRNOE00000254852	chr18:45170200-45170307	108	DHB4_RAT	38-74	37	4	A:38-74 B:38-74 (gaps) C:38-74 (gaps) D:38-74	37 37 37 37
1.4	ENSRNOT00000021646	4	ENSRNOE00000151247	chr18:45180531-45180590	60	DHB4_RAT	74-94	21	4	A:74-94 B:74-94 C:74-94 D:74-94	21 21 21 21
1.5	ENSRNOT00000021646	5	ENSRNOE00000254829	chr18:45182511-45182532	22	DHB4_RAT	94-101	8	4	A:94-101 B:94-101 C:94-101 D:94-101	8 8 8 8
1.6	ENSRNOT00000021646	6	ENSRNOE00000254822	chr18:45182636-45182682	47	DHB4_RAT	101-117	17	4	A:101-117 B:101-117 C:101-117 D:101-117	17 17 17 17
1.7	ENSRNOT00000021646	7	ENSRNOE00000151411	chr18:45184493-45184577	85	DHB4_RAT	117-145	29	4	A:117-145 B:117-145 C:117-145 D:117-145	29 29 29 29
1.8	ENSRNOT00000021646	8	ENSRNOE00000151573	chr18:45186080-45186267	188	DHB4_RAT	145-208	64	4	A:145-208 B:145-195 C:145-208 (gaps) D:145-208	64 51 64 64
1.9	ENSRNOT00000021646	9	ENSRNOE00000151726	chr18:45194421-45194512	92	DHB4_RAT	208-238	31	4	A:208-238 B:211-238 C:208-238 D:208-238	31 28 31 31
1.10	ENSRNOT00000021646	10	ENSRNOE00000254802	chr18:45197605-45197629	25	DHB4_RAT	239-247	9	4	A:239-247 B:239-247 C:239-247 D:239-247	9 9 9 9
1.11	ENSRNOT00000021646	11	ENSRNOE00000152033	chr18:45199377-45199505	129	DHB4_RAT	247-290	44	4	A:247-290 B:247-290 C:247-290 D:247-290	44 44 44 44
1.12	ENSRNOT00000021646	12	ENSRNOE00000152198	chr18:45201715-45201815	101	DHB4_RAT	290-323	34	4	A:290-304 B:290-304 C:290-304 D:290-304	15 15 15 15
1.13	ENSRNOT00000021646	13	ENSRNOE00000152337	chr18:45203708-45203944	237	DHB4_RAT	324-402	79	0	-	-
1.14	ENSRNOT00000021646	14	ENSRNOE00000152471	chr18:45206045-45206096	52	DHB4_RAT	403-420	18	0	-	-
1.15	ENSRNOT00000021646	15	ENSRNOE00000152630	chr18:45220168-45220239	72	DHB4_RAT	420-444	25	0	-	-
1.16	ENSRNOT00000021646	16	ENSRNOE00000152801	chr18:45221461-45221564	104	DHB4_RAT	444-478	35	0	-	-
1.17	ENSRNOT00000021646	17	ENSRNOE00000152976	chr18:45222854-45222919	66	DHB4_RAT	479-500	22	0	-	-
1.18	ENSRNOT00000021646	18	ENSRNOE00000153065	chr18:45226202-45226271	70	DHB4_RAT	501-524	24	0	-	-
1.19	ENSRNOT00000021646	19	ENSRNOE00000153211	chr18:45227341-45227447	107	DHB4_RAT	524-559	36	0	-	-
1.20	ENSRNOT00000021646	20	ENSRNOE00000153377	chr18:45228583-45228669	87	DHB4_RAT	560-588	29	0	-	-
1.21	ENSRNOT00000021646	21	ENSRNOE00000153541	chr18:45231385-45231471	87	DHB4_RAT	589-617	29	0	-	-
1.22	ENSRNOT00000021646	22	ENSRNOE00000153708	chr18:45232669-45232807	139	DHB4_RAT	618-664	47	0	-	-
1.24	ENSRNOT00000021646	24	ENSRNOE00000153863	chr18:45244294-45244421	128	DHB4_RAT	664-706	43	0	-	-
1.25	ENSRNOT00000021646	25	ENSRNOE00000458015	chr18:45251190-45251606	417	DHB4_RAT	707-735	29	0	-	-

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_RAT | P97852 from UniProtKB/Swiss-Prot  Length:735

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
             DHB4_RAT     3 SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
               SCOP domains d1gz6a_ A: (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4                                                                                                                                                                                                                      SCOP domains
               CATH domains 1gz6A01 A:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee....hhhhhhhhhhhhhh..eeeee............hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhh....eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee.............hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1          -----------------Exon 1.3  PDB: A:38-74 UniProt: 38-74-------------------Exon 1.5---------------Exon 1.7  PDB: A:117-145     --------------------------------------------------------------Exon 1.9  PDB: A:208-238       Exon 1.10------------------------------------------Exon 1.12       Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2           -----------------------------------Exon 1.4  PDB: A:74-9------Exon 1.6         ---------------------------Exon 1.8  PDB: A:145-208 UniProt: 145-208                       --------------------------------------Exon 1.11  PDB: A:247-290 UniProt: 247-290  -------------- Transcript 1 (2)
                 1gz6 A   3 SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHmKKQNYGRIImTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRmTETVmPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPmTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132     | 142     | 152       162       172       182       192       202  |    212       222       232       242       252       262 |     272       282       292       302  
                                                                                                                                                                 138-MSE   148-MSE                                             200-MSE|                                                        264-MSE                                    
                                                                                                                                                                                                                                    205-MSE

Chain B from PDB  Type:PROTEIN  Length:279
 aligned with DHB4_RAT | P97852 from UniProtKB/Swiss-Prot  Length:735

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
             DHB4_RAT     3 SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
               SCOP domains d1gz6b_ B: (3R)-hydroxyacyl-CoA dehydroge        nase domain of estradiol 17 beta-Dehydrogenase 4                                                                                                                                                                                                              SCOP domains
               CATH domains 1gz6B01 B:3-246 NAD(P)-binding Rossmann-l        ike Domain                                                                                                                                                                                         ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhh............--------hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh............---------------...hhhhhhhhhhhhh................eeeeeeeee...ee........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1          -----------------Exon 1.3  PDB: B:38-74 (gaps)        -------------------Exon 1.5---------------Exon 1.7  PDB: B:117-145     --------------------------------------------------------------Exon 1.9  PDB: B:211-238       Exon 1.10------------------------------------------Exon 1.12       Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2           -----------------------------------Exon 1.4  PDB: B:74-9------Exon 1.6         ---------------------------Exon 1.8  PDB: B:145-195 UniProt: 145-208 [INCOMPLETE]          --------------------------------------Exon 1.11  PDB: B:247-290 UniProt: 247-290  -------------- Transcript 1 (2)
                 1gz6 B   3 SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGG--------SSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHmKKQNYGRIImTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPN---------------EALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPmTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
                                    12        22        32        42|       52        62        72        82        92       102       112       122       132     | 142     | 152       162       172       182       192  |      -       212       222       232       242       252       262 |     272       282       292       302  
                                                                   43       52                                                                                   138-MSE   148-MSE                                        195             211                                                  264-MSE

Chain C from PDB  Type:PROTEIN  Length:288
 aligned with DHB4_RAT | P97852 from UniProtKB/Swiss-Prot  Length:735

    Alignment length:301
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303 
             DHB4_RAT     4 PLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
               SCOP domains d1gz6c_ C: (3R)-hydroxyacyl-CoA dehydrogenase d omain of estradiol 17 beta-Dehydrogenase 4                                                                                                                                                                                                                    SCOP domains
               CATH domains 1gz6C01 C:4-246 NAD(P)-binding Rossmann-like Do main                                                                                                                                                                                               ---------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee....hhhhhhhhhhhhhh..eeeee...........-hhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeeee------------hhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee.............hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1         -----------------Exon 1.3  PDB: C:38-74 (gaps)        -------------------Exon 1.5---------------Exon 1.7  PDB: C:117-145     --------------------------------------------------------------Exon 1.9  PDB: C:208-238       Exon 1.10------------------------------------------Exon 1.12       Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.2           -----------------------------------Exon 1.4  PDB: C:74-9------Exon 1.6         ---------------------------Exon 1.8  PDB: C:145-208 (gaps) UniProt: 145-208                --------------------------------------Exon 1.11  PDB: C:247-290 UniProt: 247-290  -------------- Transcript 1 (2)
                 1gz6 C   4 PLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGK-SSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHmKKQNYGRIImTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPN------------DLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPmTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
                                    13        23        33        43      | 53        63        73        83        93       103       113       123       133    |  143    |  153       163       173       183       193 |       -    |  213       223       233       243       253       263|      273       283       293       303 
                                                                         50 |                                                                                   138-MSE   148-MSE                                        195          208                                                     264-MSE                                    
                                                                           52

Chain D from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_RAT | P97852 from UniProtKB/Swiss-Prot  Length:735

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
             DHB4_RAT     3 SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
               SCOP domains d1gz6d_ D: (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4                                                                                                                                                                                                                      SCOP domains
               CATH domains 1gz6D01 D:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhh...................hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhh................eeeeeeeee...ee........hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1          -----------------Exon 1.3  PDB: D:38-74 UniProt: 38-74-------------------Exon 1.5---------------Exon 1.7  PDB: D:117-145     --------------------------------------------------------------Exon 1.9  PDB: D:208-238       Exon 1.10------------------------------------------Exon 1.12       Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2           -----------------------------------Exon 1.4  PDB: D:74-9------Exon 1.6         ---------------------------Exon 1.8  PDB: D:145-208 UniProt: 145-208                       --------------------------------------Exon 1.11  PDB: D:247-290 UniProt: 247-290  -------------- Transcript 1 (2)
                 1gz6 D   3 SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHmKKQNYGRIImTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRmTETVmPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPmTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132     | 142     | 152       162       172       182       192       202  |    212       222       232       242       252       262 |     272       282       292       302  
                                                                                                                                                                 138-MSE   148-MSE                                             200-MSE|                                                        264-MSE                                    
                                                                                                                                                                                                                                    205-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (21, 21)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (DHB4_RAT | P97852)

molecular function
	GO:0044594	17-beta-hydroxysteroid dehydrogenase (NAD+) activity	Catalysis of the reaction: a 17-beta-hydroxysteroid + NAD+ = a 17-oxosteroid + NADH + H+.
	GO:0018812	3-hydroxyacyl-CoA dehydratase activity	Catalysis of the reaction: alkene-CoA + H2O = alcohol-CoA. Substrates are crotonoyl-CoA (producing 3-hydroxyacyl-CoA) and 2,3-didehydro-pimeloyl-CoA (producing 3-hydroxypimeloyl-CoA).
	GO:0033989	3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase activity	Catalysis of the reaction: (24R,25R)-3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestanoyl-CoA = (24E)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA + H2O.
	GO:0004303	estradiol 17-beta-dehydrogenase activity	Catalysis of the reaction: estradiol-17-beta + NADP+ = estrone + NADPH + H+.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0030283	testosterone dehydrogenase [NAD(P)] activity	Catalysis of the reaction: testosterone + NAD(P)+ = androst-4-ene-3,17-dione + NAD(P)H + H+.
biological process
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0071407	cellular response to organic cyclic compound	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0008203	cholesterol metabolic process	The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
	GO:0006635	fatty acid beta-oxidation	A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0048545	response to steroid hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a steroid hormone stimulus.
cellular component
	GO:0005777	peroxisome	A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 25)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (12, 48)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File