Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF A P18(INK4C)-CDK6-K-CYCLIN TERNARY COMPLEX
 
Authors :  P. D. Jeffrey, L. Tong, N. P. Pavletich
Date :  24 Oct 00  (Deposition) - 10 Jan 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B,C,E,F,G
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  E,F,G  (1x)
Biol. Unit 3:  A,C,E,G  (1x)
Biol. Unit 4:  A,B,E,F  (1x)
Keywords :  Cyclin-Dependent Kinase, Ink4 Inhibitor, Viral Cyclin, Cell Cycle, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. D. Jeffrey, L. Tong, N. P. Pavletich
Structural Basis Of Inhibition Of Cdk-Cyclin Complexes By Ink4 Inhibitors.
Genes Dev. V. 14 3115 2000
PubMed-ID: 11124804  |  Reference-DOI: 10.1101/GAD.851100
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYCLIN-DEPENDENT KINASE 6
    Chains: A, E
    EC Number: 2.7.1.37
    Engineered: YES
    Expression System: UNIDENTIFIED BACULOVIRUS
    Expression System Strain: HI5
    Expression System Taxid: 10469
    Gene: CYCLIN-DEPENDENT KINASE 6
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CELL DIVISION PROTEIN KINASE 6, PROTEIN KINASE CDK6
 
Molecule 2 - CYCLIN-DEPENDENT KINASE 6 INHIBITOR
    Chains: B, F
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: P18(INK4C)
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: P18(INK4C), CYCLIN-DEPENDENT KINASE INHIBITOR 2C, P18, INHIBITS CDK4, CYCLIN-DEPENDENT KINASE 4 INHIBITOR C, P18-INK4C
 
Molecule 3 - V-CYCLIN
    Chains: C, G
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: K-CYCLIN (VIRAL CYCLIND HOMOLOG)
    Organism Scientific: HUMAN HERPESVIRUS 8
    Organism Taxid: 37296
    Synonym: K-CYCLIN, FUNCTIONAL CYCLIN D HOMOLOG

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCEFG
Biological Unit 1 (1x): ABC   
Biological Unit 2 (1x):    EFG
Biological Unit 3 (1x): A CE G
Biological Unit 4 (1x): AB EF 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1G3N)

(-) Sites  (0, 0)

(no "Site" information available for 1G3N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1G3N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1G3N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (5, 10)

Asymmetric Unit (5, 10)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_001490A72PCDN2C_HUMANUnclassified  ---B/FA72P
2UniProtVAR_041978D110NCDK6_HUMANPolymorphism35654944A/ED110N
3UniProtVAR_038604T126MCDN2C_HUMANPolymorphism17851380B/FT126M
4UniProtVAR_072638A197TCDK6_HUMANDisease (MCPH12)606231255A/EA197T
5UniProtVAR_041979P199LCDK6_HUMANUnclassified  ---A/EP199L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_001490A72PCDN2C_HUMANUnclassified  ---BA72P
2UniProtVAR_041978D110NCDK6_HUMANPolymorphism35654944AD110N
3UniProtVAR_038604T126MCDN2C_HUMANPolymorphism17851380BT126M
4UniProtVAR_072638A197TCDK6_HUMANDisease (MCPH12)606231255AA197T
5UniProtVAR_041979P199LCDK6_HUMANUnclassified  ---AP199L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_001490A72PCDN2C_HUMANUnclassified  ---FA72P
2UniProtVAR_041978D110NCDK6_HUMANPolymorphism35654944ED110N
3UniProtVAR_038604T126MCDN2C_HUMANPolymorphism17851380FT126M
4UniProtVAR_072638A197TCDK6_HUMANDisease (MCPH12)606231255EA197T
5UniProtVAR_041979P199LCDK6_HUMANUnclassified  ---EP199L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_041978D110NCDK6_HUMANPolymorphism35654944A/ED110N
4UniProtVAR_072638A197TCDK6_HUMANDisease (MCPH12)606231255A/EA197T
5UniProtVAR_041979P199LCDK6_HUMANUnclassified  ---A/EP199L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (5, 10)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_001490A72PCDN2C_HUMANUnclassified  ---B/FA72P
2UniProtVAR_041978D110NCDK6_HUMANPolymorphism35654944A/ED110N
3UniProtVAR_038604T126MCDN2C_HUMANPolymorphism17851380B/FT126M
4UniProtVAR_072638A197TCDK6_HUMANDisease (MCPH12)606231255A/EA197T
5UniProtVAR_041979P199LCDK6_HUMANUnclassified  ---A/EP199L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 10)

Asymmetric Unit (4, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ANK_REP_REGIONPS50297 Ankyrin repeat region circular profile.CDN2C_HUMAN9-161
 
  2B:9-160
F:9-160
2PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK6_HUMAN19-43
 
  2A:19-43
E:19-43
3ANK_REPEATPS50088 Ankyrin repeat profile.CDN2C_HUMAN69-101
 
102-128
 
  4B:69-101
F:69-101
B:102-128
F:102-128
4PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK6_HUMAN141-153
 
  2A:141-153
E:141-153
Biological Unit 1 (4, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ANK_REP_REGIONPS50297 Ankyrin repeat region circular profile.CDN2C_HUMAN9-161
 
  1B:9-160
-
2PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK6_HUMAN19-43
 
  1A:19-43
-
3ANK_REPEATPS50088 Ankyrin repeat profile.CDN2C_HUMAN69-101
 
102-128
 
  2B:69-101
-
B:102-128
-
4PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK6_HUMAN141-153
 
  1A:141-153
-
Biological Unit 2 (4, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ANK_REP_REGIONPS50297 Ankyrin repeat region circular profile.CDN2C_HUMAN9-161
 
  1-
F:9-160
2PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK6_HUMAN19-43
 
  1-
E:19-43
3ANK_REPEATPS50088 Ankyrin repeat profile.CDN2C_HUMAN69-101
 
102-128
 
  2-
F:69-101
-
F:102-128
4PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK6_HUMAN141-153
 
  1-
E:141-153
Biological Unit 3 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ANK_REP_REGIONPS50297 Ankyrin repeat region circular profile.CDN2C_HUMAN9-161
 
  0-
-
2PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK6_HUMAN19-43
 
  2A:19-43
E:19-43
3ANK_REPEATPS50088 Ankyrin repeat profile.CDN2C_HUMAN69-101
 
102-128
 
  0-
-
-
-
4PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK6_HUMAN141-153
 
  2A:141-153
E:141-153
Biological Unit 4 (4, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ANK_REP_REGIONPS50297 Ankyrin repeat region circular profile.CDN2C_HUMAN9-161
 
  2B:9-160
F:9-160
2PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK6_HUMAN19-43
 
  2A:19-43
E:19-43
3ANK_REPEATPS50088 Ankyrin repeat profile.CDN2C_HUMAN69-101
 
102-128
 
  4B:69-101
F:69-101
B:102-128
F:102-128
4PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK6_HUMAN141-153
 
  2A:141-153
E:141-153

(-) Exons   (9, 18)

Asymmetric Unit (9, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.3ENST000002657343ENSE00001337042chr7:92463231-9246318745CDK6_HUMAN-00--
1.4bENST000002657344bENSE00001132651chr7:92463004-92462405600CDK6_HUMAN1-78782A:9-78
E:9-78
70
70
1.5ENST000002657345ENSE00000877375chr7:92404145-92404010136CDK6_HUMAN78-123462A:78-123
E:78-123
46
46
1.6aENST000002657346aENSE00000877376chr7:92355107-92354940168CDK6_HUMAN124-179562A:124-179
E:124-179
56
56
1.7aENST000002657347aENSE00001764561chr7:92300849-92300740110CDK6_HUMAN180-216372A:180-216
E:180-216
37
37
1.8ENST000002657348ENSE00000705202chr7:92252400-9225235051CDK6_HUMAN216-233182A:216-233
E:216-233
18
18
1.9bENST000002657349bENSE00000705199chr7:92247521-92247386136CDK6_HUMAN233-278462A:233-278
E:233-278
46
46
1.10cENST0000026573410cENSE00001132644chr7:92244600-9223423510366CDK6_HUMAN279-326482A:279-301
E:279-301
23
23

2.2bENST000003961482bENSE00001524054chr1:51434367-514355711205CDN2C_HUMAN-00--
2.3bENST000003961483bENSE00001064516chr1:51436030-51436169140CDN2C_HUMAN1-43432B:6-43
F:6-43
38
38
2.4bENST000003961484bENSE00001064515chr1:51439565-51440305741CDN2C_HUMAN44-1681252B:44-160
F:44-160
117
117

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:293
 aligned with CDK6_HUMAN | Q00534 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:293
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298   
           CDK6_HUMAN     9 ADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ 301
               SCOP domains d1g3na_ A: Cyclin-dependent PK, CDK6                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains --1g3nA01 A:11-102 Phosphorylase Kinase; domain 1                                             1g3nA02 A:103-299 Transferase(Phosphotransferase) domain 1                                                                                                                                           -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeee..eeeeeeee......eeeeeeeeee......hhhhhhhhhhhhhhhhh.......eeeeeeee....eeeeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.......eeee....eeee.hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhh......hhhhh......hhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------N--------------------------------------------------------------------------------------T-L------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------PROTEIN_KINASE_ATP       -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4b  PDB: A:9-78 UniProt: 1-78 [INCOMPLETE]                     ---------------------------------------------Exon 1.6a  PDB: A:124-179 UniProt: 124-179              Exon 1.7a  PDB: A:180-216            ----------------Exon 1.9b  PDB: A:233-278 UniProt: 233-278    Exon 1.10c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.5  PDB: A:78-123 UniProt: 78-123       --------------------------------------------------------------------------------------------Exon 1.8          -------------------------------------------------------------------- Transcript 1 (2)
                 1g3n A   9 ADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ 301
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298   

Chain B from PDB  Type:PROTEIN  Length:155
 aligned with CDN2C_HUMAN | P42773 from UniProtKB/Swiss-Prot  Length:168

    Alignment length:155
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155     
          CDN2C_HUMAN     6 GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG 160
               SCOP domains d1g3nb_ B: p18ink4C(ink6)                                                                                                                                   SCOP domains
               CATH domains 1g3nB00 B:6-160  [code=1.25.40.20, no name defined]                                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh..............hhhhhh...hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------P-----------------------------------------------------M---------------------------------- SAPs(SNPs)
                PROSITE (1) ---ANK_REP_REGION  PDB: B:9-160 UniProt: 9-161                                                                                                              PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------ANK_REPEAT  PDB: B:69-101        ANK_REPEAT  PDB: B:102-128 -------------------------------- PROSITE (2)
               Transcript 2 Exon 2.3b  PDB: B:6-43 UniProt: 1-43  Exon 2.4b  PDB: B:44-160 UniProt: 44-168 [INCOMPLETE]                                                                 Transcript 2
                 1g3n B   6 GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG 160
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155     

Chain C from PDB  Type:PROTEIN  Length:233
 aligned with O40946_HHV8 | O40946 from UniProtKB/TrEMBL  Length:257

    Alignment length:238
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245        
          O40946_HHV8    16 LCEDRIFYNILEIEPRFLTSDSVFGSFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLLGGSQHLDFWHHEVNTLITKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSGGVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
               SCOP domains d1g3nc1 C:16-147 Viral cyclin                                                                                                       d1g3nc2 C:148-253 Viral cyclin                                                                             SCOP domains
               CATH domains 1g3nC01            1g3nC02 C:35-147  [code=1.10.472.10, no name defined]                                                            1g3nC01 C:16-34,C:148-253  [code=1.10.472.10, no name defined]                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh.hhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..-----hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g3n C  16 LCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALVDPLTGSLPASIISAAGCALLVPANVIPQ-----GVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       | -   |   225       235       245        
                                                                                                                                                                                                                               213   219                                  

Chain C from PDB  Type:PROTEIN  Length:233
 aligned with Q98147_HHV8 | Q98147 from UniProtKB/TrEMBL  Length:257

    Alignment length:238
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245        
          Q98147_HHV8    16 LCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSGGVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
               SCOP domains d1g3nc1 C:16-147 Viral cyclin                                                                                                       d1g3nc2 C:148-253 Viral cyclin                                                                             SCOP domains
               CATH domains 1g3nC01            1g3nC02 C:35-147  [code=1.10.472.10, no name defined]                                                            1g3nC01 C:16-34,C:148-253  [code=1.10.472.10, no name defined]                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh.hhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..-----hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g3n C  16 LCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALVDPLTGSLPASIISAAGCALLVPANVIPQ-----GVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       | -   |   225       235       245        
                                                                                                                                                                                                                               213   219                                  

Chain E from PDB  Type:PROTEIN  Length:293
 aligned with CDK6_HUMAN | Q00534 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:293
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298   
           CDK6_HUMAN     9 ADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ 301
               SCOP domains d1g3ne_ E: Cyclin-dependent PK, CDK6                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains --1g3nE01 E:11-102 Phosphorylase Kinase; domain 1                                             1g3nE02 E:103-299 Transferase(Phosphotransferase) domain 1                                                                                                                                           -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeee..eeeeeeee......eeeeeeeeee......hhhhhhhhhhhhhhhhh.......eeeeeeee....eeeeeeeee....hhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.......eeee....eeee.hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.............hhhhh......hhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------N--------------------------------------------------------------------------------------T-L------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ----------PROTEIN_KINASE_ATP       -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4b  PDB: E:9-78 UniProt: 1-78 [INCOMPLETE]                     ---------------------------------------------Exon 1.6a  PDB: E:124-179 UniProt: 124-179              Exon 1.7a  PDB: E:180-216            ----------------Exon 1.9b  PDB: E:233-278 UniProt: 233-278    Exon 1.10c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.5  PDB: E:78-123 UniProt: 78-123       --------------------------------------------------------------------------------------------Exon 1.8          -------------------------------------------------------------------- Transcript 1 (2)
                 1g3n E   9 ADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ 301
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298   

Chain F from PDB  Type:PROTEIN  Length:155
 aligned with CDN2C_HUMAN | P42773 from UniProtKB/Swiss-Prot  Length:168

    Alignment length:155
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155     
          CDN2C_HUMAN     6 GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG 160
               SCOP domains d1g3nf_ F: p18ink4C(ink6)                                                                                                                                   SCOP domains
               CATH domains 1g3nF00 F:6-160  [code=1.25.40.20, no name defined]                                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh..............hhhhhh...hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------P-----------------------------------------------------M---------------------------------- SAPs(SNPs)
                PROSITE (1) ---ANK_REP_REGION  PDB: F:9-160 UniProt: 9-161                                                                                                              PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------ANK_REPEAT  PDB: F:69-101        ANK_REPEAT  PDB: F:102-128 -------------------------------- PROSITE (2)
               Transcript 2 Exon 2.3b  PDB: F:6-43 UniProt: 1-43  Exon 2.4b  PDB: F:44-160 UniProt: 44-168 [INCOMPLETE]                                                                 Transcript 2
                 1g3n F   6 GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG 160
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155     

Chain G from PDB  Type:PROTEIN  Length:233
 aligned with O40946_HHV8 | O40946 from UniProtKB/TrEMBL  Length:257

    Alignment length:238
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245        
          O40946_HHV8    16 LCEDRIFYNILEIEPRFLTSDSVFGSFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLLGGSQHLDFWHHEVNTLITKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSGGVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
               SCOP domains d1g3ng1 G:16-147 Viral cyclin                                                                                                       d1g3ng2 G:148-253 Viral cyclin                                                                             SCOP domains
               CATH domains 1g3nG01            1g3nG02 G:35-147  [code=1.10.472.10, no name defined]                                                            1g3nG01 G:16-34,G:148-252  [code=1.10.472.10, no name defined]                                           - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh.hhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh....hhhhhhhhhhhhhhhh........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..-----hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g3n G  16 LCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALVDPLTGSLPASIISAAGCALLVPANVIPQ-----GVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       | -   |   225       235       245        
                                                                                                                                                                                                                               213   219                                  

Chain G from PDB  Type:PROTEIN  Length:233
 aligned with Q98147_HHV8 | Q98147 from UniProtKB/TrEMBL  Length:257

    Alignment length:238
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245        
          Q98147_HHV8    16 LCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSGGVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
               SCOP domains d1g3ng1 G:16-147 Viral cyclin                                                                                                       d1g3ng2 G:148-253 Viral cyclin                                                                             SCOP domains
               CATH domains 1g3nG01            1g3nG02 G:35-147  [code=1.10.472.10, no name defined]                                                            1g3nG01 G:16-34,G:148-252  [code=1.10.472.10, no name defined]                                           - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh.hhhhh.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh....hhhhhhhhhhhhhhhh........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..-----hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g3n G  16 LCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALVDPLTGSLPASIISAAGCALLVPANVIPQ-----GVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI 253
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       | -   |   225       235       245        
                                                                                                                                                                                                                               213   219                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 8)

Asymmetric Unit

(-) CATH Domains  (4, 10)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1G3N)

(-) Gene Ontology  (60, 71)

Asymmetric Unit(hide GO term definitions)
Chain A,E   (CDK6_HUMAN | Q00534)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0030332    cyclin binding    Interacting selectively and non-covalently with cyclins, proteins whose levels in a cell varies markedly during the cell cycle, rising steadily until mitosis, then falling abruptly to zero. As cyclins reach a threshold level, they are thought to drive cells into G2 phase and thus to mitosis.
    GO:0004693    cyclin-dependent protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate. This reaction requires the binding of a regulatory cyclin subunit and full activity requires stimulatory phosphorylation by a CDK-activating kinase (CAK).
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0000082    G1/S transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0033077    T cell differentiation in thymus    The process in which a precursor cell type acquires the specialized features of a T cell via a differentiation pathway dependent upon transit through the thymus.
    GO:0014002    astrocyte development    The process aimed at the progression of an astrocyte over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell. An astrocyte is the most abundant type of glial cell. Astrocytes provide support for neurons and regulate the environment in which they function.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0043697    cell dedifferentiation    The process in which a specialized cell loses the structural or functional features that characterize it in the mature organism, or some other relatively stable phase of the organism's life history. Under certain conditions, these cells can revert back to the features of the stem cells that were their ancestors.
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0021542    dentate gyrus development    The process whose specific outcome is the progression of the dentate gyrus over time, from its formation to the mature structure. The dentate gyrus is one of two interlocking gyri of the hippocampus. It contains granule cells, which project to the pyramidal cells and interneurons of the CA3 region of the ammon gyrus.
    GO:0048699    generation of neurons    The process in which nerve cells are generated. This includes the production of neuroblasts and their differentiation into neurons.
    GO:0042063    gliogenesis    The process that results in the generation of glial cells. This includes the production of glial progenitors and their differentiation into mature glia.
    GO:0002244    hematopoietic progenitor cell differentiation    The process in which precursor cell type acquires the specialized features of a hematopoietic progenitor cell, a class of cell types including myeloid progenitor cells and lymphoid progenitor cells.
    GO:0060218    hematopoietic stem cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a hematopoietic stem cell. A stem cell is a cell that retains the ability to divide and proliferate throughout life to provide progenitor cells that can differentiate into specialized cells.
    GO:0030097    hemopoiesis    The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
    GO:0021670    lateral ventricle development    The process whose specific outcome is the progression of the lateral ventricles over time, from the formation to the mature structure. The two lateral ventricles are a cavity in each of the cerebral hemispheres derived from the cavity of the embryonic neural tube. They are separated from each other by the septum pellucidum, and each communicates with the third ventricle by the foramen of Monro, through which also the choroid plexuses of the lateral ventricles become continuous with that of the third ventricle.
    GO:0045786    negative regulation of cell cycle    Any process that stops, prevents or reduces the rate or extent of progression through the cell cycle.
    GO:0045596    negative regulation of cell differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of cell differentiation.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:2000773    negative regulation of cellular senescence    Any process that stops, prevents or reduces the frequency, rate or extent of cellular senescence.
    GO:0050680    negative regulation of epithelial cell proliferation    Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
    GO:0045638    negative regulation of myeloid cell differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of myeloid cell differentiation.
    GO:0045668    negative regulation of osteoblast differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of osteoblast differentiation.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0001954    positive regulation of cell-matrix adhesion    Any process that activates or increases the rate or extent of cell adhesion to an extracellular matrix.
    GO:0048146    positive regulation of fibroblast proliferation    Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:2000145    regulation of cell motility    Any process that modulates the frequency, rate or extent of cell motility.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0045646    regulation of erythrocyte differentiation    Any process that modulates the frequency, rate or extent of erythrocyte differentiation.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0009615    response to virus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
    GO:0003323    type B pancreatic cell development    The process whose specific outcome is the progression of a type B pancreatic cell over time, from its formation to the mature structure. A type B pancreatic cell is a cell located towards center of the islets of Langerhans that secretes insulin.
cellular component
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0000307    cyclin-dependent protein kinase holoenzyme complex    Cyclin-dependent protein kinases (CDKs) are enzyme complexes that contain a kinase catalytic subunit associated with a regulatory cyclin partner.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0001726    ruffle    Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.

Chain B,F   (CDN2C_HUMAN | P42773)
molecular function
    GO:0004861    cyclin-dependent protein serine/threonine kinase inhibitor activity    Stops, prevents or reduces the activity of a cyclin-dependent protein serine/threonine kinase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0000082    G1/S transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0042326    negative regulation of phosphorylation    Any process that stops, prevents or decreases the rate of addition of phosphate groups to a molecule.
    GO:0071901    negative regulation of protein serine/threonine kinase activity    Any process that decreases the rate, frequency, or extent of protein serine/threonine kinase activity.
    GO:0048709    oligodendrocyte differentiation    The process in which a relatively unspecialized cell acquires the specialized features of an oligodendrocyte. An oligodendrocyte is a type of glial cell involved in myelinating the axons of neurons in the central nervous system.
    GO:0000079    regulation of cyclin-dependent protein serine/threonine kinase activity    Any process that modulates the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,G   (Q98147_HHV8 | Q98147)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.

Chain C,G   (O40946_HHV8 | O40946)
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1g3n)
 
  Sites
(no "Sites" information available for 1g3n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1g3n)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1g3n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CDK6_HUMAN | Q00534
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CDN2C_HUMAN | P42773
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  O40946_HHV8 | O40946
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q98147_HHV8 | Q98147
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.37
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  616080
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CDK6_HUMAN | Q00534
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CDN2C_HUMAN | P42773
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  O40946_HHV8 | O40946
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q98147_HHV8 | Q98147
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CDK6_HUMAN | Q00534: 1bi7 1bi8 1blx 1jow 1xo2 2euf 2f2c 3nup 3nux 4aua 4ez5 4tth 5l2i 5l2s 5l2t
        CDN2C_HUMAN | P42773: 1bu9 1ihb 1mx2 1mx4 1mx6

(-) Related Entries Specified in the PDB File

1bi7 P16(INK4A)-CDK6 BINARY COMPLEX
1bi8 P19(INK4D)-CDK6 BINARY COMPLEX