1BI7 - JenaLib

Asymmetric Unit (95, 95)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_001408	D	14	E	CDN2A_HUMAN	Unclassified	---	B	D	14	E
02	UniProt	VAR_001409	L	16	P	CDN2A_HUMAN	Unclassified	---	B	L	16	P
03	UniProt	VAR_001410	A	20	P	CDN2A_HUMAN	Unclassified	---	B	A	20	P
04	UniProt	VAR_001411	A	20	S	CDN2A_HUMAN	Unclassified	760065045	B	A	20	S
05	UniProt	VAR_001412	G	23	D	CDN2A_HUMAN	Unclassified	---	B	G	23	D
06	UniProt	VAR_001413	R	24	C	CDN2A_HUMAN	Disease (CMM2)	---	B	R	24	C
07	UniProt	VAR_001414	R	24	P	CDN2A_HUMAN	Disease (CMM2)	104894097	B	R	24	P
08	UniProt	VAR_058550	R	24	Q	CDN2A_HUMAN	Polymorphism	104894097	B	R	24	Q
09	UniProt	VAR_001415	E	26	D	CDN2A_HUMAN	Unclassified	---	B	E	26	D
10	UniProt	VAR_001416	L	32	P	CDN2A_HUMAN	Disease (CMM2)	878853650	B	L	32	P
11	UniProt	VAR_001417	E	33	D	CDN2A_HUMAN	Unclassified	---	B	E	33	D
12	UniProt	VAR_001418	G	35	A	CDN2A_HUMAN	Disease (CMM2)	746834149	B	G	35	A
13	UniProt	VAR_001419	G	35	E	CDN2A_HUMAN	Disease (CMM2)	746834149	B	G	35	E
14	UniProt	VAR_058551	G	35	V	CDN2A_HUMAN	Disease (CMM2)	---	B	G	35	V
15	UniProt	VAR_001420	P	48	L	CDN2A_HUMAN	Disease (CMM2)	---	B	P	48	L
16	UniProt	VAR_001421	I	49	S	CDN2A_HUMAN	Unclassified	---	B	I	49	S
17	UniProt	VAR_001422	I	49	T	CDN2A_HUMAN	Polymorphism	199907548	B	I	49	T
18	UniProt	VAR_001423	Q	50	R	CDN2A_HUMAN	Disease (CMM2)	587778189	B	Q	50	R
19	UniProt	VAR_001424	M	53	I	CDN2A_HUMAN	Disease (CMM2)	104894095	B	M	53	I
20	UniProt	VAR_001425	S	56	I	CDN2A_HUMAN	Polymorphism	104894109	B	S	56	I
21	UniProt	VAR_001426	A	57	V	CDN2A_HUMAN	Unclassified	372266620	B	A	57	V
22	UniProt	VAR_053027	R	58	Q	CDN2A_HUMAN	Polymorphism	36204273	B	R	58	Q
23	UniProt	VAR_001427	V	59	G	CDN2A_HUMAN	Disease (CMM2)	104894099	B	V	59	G
24	UniProt	VAR_001428	A	60	T	CDN2A_HUMAN	Polymorphism	769382085	B	A	60	T
25	UniProt	VAR_053028	A	60	V	CDN2A_HUMAN	Unclassified	36204594	B	A	60	V
26	UniProt	VAR_001430	L	62	P	CDN2A_HUMAN	Disease (CMM2)	---	B	L	62	P
27	UniProt	VAR_001431	H	66	Y	CDN2A_HUMAN	Unclassified	---	B	H	66	Y
28	UniProt	VAR_058553	G	67	R	CDN2A_HUMAN	Disease (CMM2)	758389471	B	G	67	R
29	UniProt	VAR_001432	A	68	L	CDN2A_HUMAN	Disease (CMM2)	876658534	B	A	68	L
30	UniProt	VAR_001433	A	68	T	CDN2A_HUMAN	Unclassified	---	B	A	68	T
31	UniProt	VAR_001434	A	68	V	CDN2A_HUMAN	Polymorphism	---	B	A	68	V
32	UniProt	VAR_058554	E	69	G	CDN2A_HUMAN	Polymorphism	372670098	B	E	69	G
33	UniProt	VAR_001435	E	69	K	CDN2A_HUMAN	Unclassified	---	B	E	69	K
34	UniProt	VAR_001436	E	69	V	CDN2A_HUMAN	Unclassified	---	B	E	69	V
35	UniProt	VAR_001437	N	71	K	CDN2A_HUMAN	Disease (CMM2)	---	B	N	71	K
36	UniProt	VAR_001438	N	71	S	CDN2A_HUMAN	Polymorphism	559848002	B	N	71	S
37	UniProt	VAR_001439	C	72	G	CDN2A_HUMAN	Unclassified	---	B	C	72	G
38	UniProt	VAR_001440	D	74	N	CDN2A_HUMAN	Unclassified	---	B	D	74	N
39	UniProt	VAR_001441	D	74	V	CDN2A_HUMAN	Unclassified	---	B	D	74	V
40	UniProt	VAR_058555	D	74	Y	CDN2A_HUMAN	Disease (CMM2)	760640852	B	D	74	Y
41	UniProt	VAR_058556	T	77	P	CDN2A_HUMAN	Disease (CMM2)	---	B	T	77	P
42	UniProt	VAR_001442	R	80	L	CDN2A_HUMAN	Unclassified	---	B	R	80	L
43	UniProt	VAR_058557	R	80	P	CDN2A_HUMAN	Disease (CMM2)	---	B	R	80	P
44	UniProt	VAR_001443	P	81	L	CDN2A_HUMAN	Unclassified	11552823	B	P	81	L
45	UniProt	VAR_058558	P	81	T	CDN2A_HUMAN	Disease (CMM2)	---	B	P	81	T
46	UniProt	VAR_001445	H	83	N	CDN2A_HUMAN	Unclassified	---	B	H	83	N
47	UniProt	VAR_053029	H	83	Q	CDN2A_HUMAN	Polymorphism	34968276	B	H	83	Q
48	UniProt	VAR_001444	H	83	Y	CDN2A_HUMAN	Unclassified	121913385	B	H	83	Y
49	UniProt	VAR_001446	D	84	E	CDN2A_HUMAN	Unclassified	---	B	D	84	E
50	UniProt	VAR_001447	D	84	H	CDN2A_HUMAN	Unclassified	---	B	D	84	H
51	UniProt	VAR_001448	D	84	N	CDN2A_HUMAN	Unclassified	11552822	B	D	84	N
52	UniProt	VAR_001449	D	84	Y	CDN2A_HUMAN	Disease (CMM2)	11552822	B	D	84	Y
53	UniProt	VAR_001450	A	85	T	CDN2A_HUMAN	Polymorphism	878853646	B	A	85	T
54	UniProt	VAR_001451	R	87	P	CDN2A_HUMAN	Disease (CMM2)	878853647	B	R	87	P
55	UniProt	VAR_012317	R	87	W	CDN2A_HUMAN	Disease (CMM2)	749714198	B	R	87	W
56	UniProt	VAR_001452	E	88	D	CDN2A_HUMAN	Unclassified	---	B	E	88	D
57	UniProt	VAR_001453	G	89	D	CDN2A_HUMAN	Disease (CMM2)	137854599	B	G	89	D
58	UniProt	VAR_001454	G	89	S	CDN2A_HUMAN	Disease (CMM2)	137854597	B	G	89	S
59	UniProt	VAR_001455	T	93	A	CDN2A_HUMAN	Unclassified	---	B	T	93	A
60	UniProt	VAR_023604	L	94	Q	CDN2A_HUMAN	Disease (CMM2)	---	B	L	94	Q
61	UniProt	VAR_001456	V	95	A	CDN2A_HUMAN	Unclassified	---	B	V	95	A
62	UniProt	VAR_001457	L	97	R	CDN2A_HUMAN	Disease (CMM2)	---	B	L	97	R
63	UniProt	VAR_001458	H	98	P	CDN2A_HUMAN	Disease (CMM2)	---	B	H	98	P
64	UniProt	VAR_001459	H	98	Q	CDN2A_HUMAN	Disease (CMM2)	---	B	H	98	Q
65	UniProt	VAR_001460	R	99	P	CDN2A_HUMAN	Disease (CMM2)	---	B	R	99	P
66	UniProt	VAR_001461	R	99	Q	CDN2A_HUMAN	Unclassified	754806883	B	R	99	Q
67	UniProt	VAR_053030	R	99	W	CDN2A_HUMAN	Polymorphism	34886500	B	R	99	W
68	UniProt	VAR_001462	A	100	L	CDN2A_HUMAN	Disease (CMM2)	---	B	A	100	L
69	UniProt	VAR_001463	A	100	P	CDN2A_HUMAN	Polymorphism	---	B	A	100	P
70	UniProt	VAR_001464	G	101	W	CDN2A_HUMAN	Disease (CMM2)	104894094	B	G	101	W
71	UniProt	VAR_015818	A	102	E	CDN2A_HUMAN	Polymorphism	137854598	B	A	102	E
72	UniProt	VAR_053031	A	102	T	CDN2A_HUMAN	Polymorphism	35741010	B	A	102	T
73	UniProt	VAR_001466	R	107	C	CDN2A_HUMAN	Disease (CMM2)	---	B	R	107	C
74	UniProt	VAR_001467	R	107	H	CDN2A_HUMAN	Polymorphism	370823171	B	R	107	H
75	UniProt	VAR_001469	D	108	H	CDN2A_HUMAN	Unclassified	---	B	D	108	H
76	UniProt	VAR_001468	D	108	Y	CDN2A_HUMAN	Unclassified	121913381	B	D	108	Y
77	UniProt	VAR_041978	D	110	N	CDK6_HUMAN	Polymorphism	35654944	A	D	110	N
78	UniProt	VAR_001470	P	114	L	CDN2A_HUMAN	Unclassified	121913386	B	P	114	L
79	UniProt	VAR_058559	P	114	S	CDN2A_HUMAN	Polymorphism	104894104	B	P	114	S
80	UniProt	VAR_001471	L	117	M	CDN2A_HUMAN	Disease (CMM2)	---	B	L	117	M
81	UniProt	VAR_001472	A	118	T	CDN2A_HUMAN	Disease (CMM2)	---	B	A	118	T
82	UniProt	VAR_001473	E	119	Q	CDN2A_HUMAN	Unclassified	---	B	E	119	Q
83	UniProt	VAR_001474	E	120	A	CDN2A_HUMAN	Unclassified	---	B	E	120	A
84	UniProt	VAR_001475	E	120	K	CDN2A_HUMAN	Unclassified	---	B	E	120	K
85	UniProt	VAR_035069	G	122	R	CDN2A_HUMAN	Disease (CMM2)	113798404	B	G	122	R
86	UniProt	VAR_001476	G	122	S	CDN2A_HUMAN	Unclassified	113798404	B	G	122	S
87	UniProt	VAR_001477	H	123	Q	CDN2A_HUMAN	Unclassified	6413463	B	H	123	Q
88	UniProt	VAR_053032	R	124	C	CDN2A_HUMAN	Polymorphism	34170727	B	R	124	C
89	UniProt	VAR_001478	R	124	H	CDN2A_HUMAN	Unclassified	747621669	B	R	124	H
90	UniProt	VAR_001479	V	126	D	CDN2A_HUMAN	Disease (CMM2)	104894098	B	V	126	D
91	UniProt	VAR_001480	A	127	S	CDN2A_HUMAN	Unclassified	6413464	B	A	127	S
92	UniProt	VAR_001481	A	132	P	CDN2A_HUMAN	Unclassified	---	B	A	132	P
93	UniProt	VAR_001482	A	134	V	CDN2A_HUMAN	Unclassified	757497674	B	A	134	V
94	UniProt	VAR_072638	A	197	T	CDK6_HUMAN	Disease (MCPH12)	606231255	A	A	197	T
95	UniProt	VAR_041979	P	199	L	CDK6_HUMAN	Unclassified	---	A	P	199	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (95, 190)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_001408	D	14	E	CDN2A_HUMAN	Unclassified	---	B	D	14	E
02	UniProt	VAR_001409	L	16	P	CDN2A_HUMAN	Unclassified	---	B	L	16	P
03	UniProt	VAR_001410	A	20	P	CDN2A_HUMAN	Unclassified	---	B	A	20	P
04	UniProt	VAR_001411	A	20	S	CDN2A_HUMAN	Unclassified	760065045	B	A	20	S
05	UniProt	VAR_001412	G	23	D	CDN2A_HUMAN	Unclassified	---	B	G	23	D
06	UniProt	VAR_001413	R	24	C	CDN2A_HUMAN	Disease (CMM2)	---	B	R	24	C
07	UniProt	VAR_001414	R	24	P	CDN2A_HUMAN	Disease (CMM2)	104894097	B	R	24	P
08	UniProt	VAR_058550	R	24	Q	CDN2A_HUMAN	Polymorphism	104894097	B	R	24	Q
09	UniProt	VAR_001415	E	26	D	CDN2A_HUMAN	Unclassified	---	B	E	26	D
10	UniProt	VAR_001416	L	32	P	CDN2A_HUMAN	Disease (CMM2)	878853650	B	L	32	P
11	UniProt	VAR_001417	E	33	D	CDN2A_HUMAN	Unclassified	---	B	E	33	D
12	UniProt	VAR_001418	G	35	A	CDN2A_HUMAN	Disease (CMM2)	746834149	B	G	35	A
13	UniProt	VAR_001419	G	35	E	CDN2A_HUMAN	Disease (CMM2)	746834149	B	G	35	E
14	UniProt	VAR_058551	G	35	V	CDN2A_HUMAN	Disease (CMM2)	---	B	G	35	V
15	UniProt	VAR_001420	P	48	L	CDN2A_HUMAN	Disease (CMM2)	---	B	P	48	L
16	UniProt	VAR_001421	I	49	S	CDN2A_HUMAN	Unclassified	---	B	I	49	S
17	UniProt	VAR_001422	I	49	T	CDN2A_HUMAN	Polymorphism	199907548	B	I	49	T
18	UniProt	VAR_001423	Q	50	R	CDN2A_HUMAN	Disease (CMM2)	587778189	B	Q	50	R
19	UniProt	VAR_001424	M	53	I	CDN2A_HUMAN	Disease (CMM2)	104894095	B	M	53	I
20	UniProt	VAR_001425	S	56	I	CDN2A_HUMAN	Polymorphism	104894109	B	S	56	I
21	UniProt	VAR_001426	A	57	V	CDN2A_HUMAN	Unclassified	372266620	B	A	57	V
22	UniProt	VAR_053027	R	58	Q	CDN2A_HUMAN	Polymorphism	36204273	B	R	58	Q
23	UniProt	VAR_001427	V	59	G	CDN2A_HUMAN	Disease (CMM2)	104894099	B	V	59	G
24	UniProt	VAR_001428	A	60	T	CDN2A_HUMAN	Polymorphism	769382085	B	A	60	T
25	UniProt	VAR_053028	A	60	V	CDN2A_HUMAN	Unclassified	36204594	B	A	60	V
26	UniProt	VAR_001430	L	62	P	CDN2A_HUMAN	Disease (CMM2)	---	B	L	62	P
27	UniProt	VAR_001431	H	66	Y	CDN2A_HUMAN	Unclassified	---	B	H	66	Y
28	UniProt	VAR_058553	G	67	R	CDN2A_HUMAN	Disease (CMM2)	758389471	B	G	67	R
29	UniProt	VAR_001432	A	68	L	CDN2A_HUMAN	Disease (CMM2)	876658534	B	A	68	L
30	UniProt	VAR_001433	A	68	T	CDN2A_HUMAN	Unclassified	---	B	A	68	T
31	UniProt	VAR_001434	A	68	V	CDN2A_HUMAN	Polymorphism	---	B	A	68	V
32	UniProt	VAR_058554	E	69	G	CDN2A_HUMAN	Polymorphism	372670098	B	E	69	G
33	UniProt	VAR_001435	E	69	K	CDN2A_HUMAN	Unclassified	---	B	E	69	K
34	UniProt	VAR_001436	E	69	V	CDN2A_HUMAN	Unclassified	---	B	E	69	V
35	UniProt	VAR_001437	N	71	K	CDN2A_HUMAN	Disease (CMM2)	---	B	N	71	K
36	UniProt	VAR_001438	N	71	S	CDN2A_HUMAN	Polymorphism	559848002	B	N	71	S
37	UniProt	VAR_001439	C	72	G	CDN2A_HUMAN	Unclassified	---	B	C	72	G
38	UniProt	VAR_001440	D	74	N	CDN2A_HUMAN	Unclassified	---	B	D	74	N
39	UniProt	VAR_001441	D	74	V	CDN2A_HUMAN	Unclassified	---	B	D	74	V
40	UniProt	VAR_058555	D	74	Y	CDN2A_HUMAN	Disease (CMM2)	760640852	B	D	74	Y
41	UniProt	VAR_058556	T	77	P	CDN2A_HUMAN	Disease (CMM2)	---	B	T	77	P
42	UniProt	VAR_001442	R	80	L	CDN2A_HUMAN	Unclassified	---	B	R	80	L
43	UniProt	VAR_058557	R	80	P	CDN2A_HUMAN	Disease (CMM2)	---	B	R	80	P
44	UniProt	VAR_001443	P	81	L	CDN2A_HUMAN	Unclassified	11552823	B	P	81	L
45	UniProt	VAR_058558	P	81	T	CDN2A_HUMAN	Disease (CMM2)	---	B	P	81	T
46	UniProt	VAR_001445	H	83	N	CDN2A_HUMAN	Unclassified	---	B	H	83	N
47	UniProt	VAR_053029	H	83	Q	CDN2A_HUMAN	Polymorphism	34968276	B	H	83	Q
48	UniProt	VAR_001444	H	83	Y	CDN2A_HUMAN	Unclassified	121913385	B	H	83	Y
49	UniProt	VAR_001446	D	84	E	CDN2A_HUMAN	Unclassified	---	B	D	84	E
50	UniProt	VAR_001447	D	84	H	CDN2A_HUMAN	Unclassified	---	B	D	84	H
51	UniProt	VAR_001448	D	84	N	CDN2A_HUMAN	Unclassified	11552822	B	D	84	N
52	UniProt	VAR_001449	D	84	Y	CDN2A_HUMAN	Disease (CMM2)	11552822	B	D	84	Y
53	UniProt	VAR_001450	A	85	T	CDN2A_HUMAN	Polymorphism	878853646	B	A	85	T
54	UniProt	VAR_001451	R	87	P	CDN2A_HUMAN	Disease (CMM2)	878853647	B	R	87	P
55	UniProt	VAR_012317	R	87	W	CDN2A_HUMAN	Disease (CMM2)	749714198	B	R	87	W
56	UniProt	VAR_001452	E	88	D	CDN2A_HUMAN	Unclassified	---	B	E	88	D
57	UniProt	VAR_001453	G	89	D	CDN2A_HUMAN	Disease (CMM2)	137854599	B	G	89	D
58	UniProt	VAR_001454	G	89	S	CDN2A_HUMAN	Disease (CMM2)	137854597	B	G	89	S
59	UniProt	VAR_001455	T	93	A	CDN2A_HUMAN	Unclassified	---	B	T	93	A
60	UniProt	VAR_023604	L	94	Q	CDN2A_HUMAN	Disease (CMM2)	---	B	L	94	Q
61	UniProt	VAR_001456	V	95	A	CDN2A_HUMAN	Unclassified	---	B	V	95	A
62	UniProt	VAR_001457	L	97	R	CDN2A_HUMAN	Disease (CMM2)	---	B	L	97	R
63	UniProt	VAR_001458	H	98	P	CDN2A_HUMAN	Disease (CMM2)	---	B	H	98	P
64	UniProt	VAR_001459	H	98	Q	CDN2A_HUMAN	Disease (CMM2)	---	B	H	98	Q
65	UniProt	VAR_001460	R	99	P	CDN2A_HUMAN	Disease (CMM2)	---	B	R	99	P
66	UniProt	VAR_001461	R	99	Q	CDN2A_HUMAN	Unclassified	754806883	B	R	99	Q
67	UniProt	VAR_053030	R	99	W	CDN2A_HUMAN	Polymorphism	34886500	B	R	99	W
68	UniProt	VAR_001462	A	100	L	CDN2A_HUMAN	Disease (CMM2)	---	B	A	100	L
69	UniProt	VAR_001463	A	100	P	CDN2A_HUMAN	Polymorphism	---	B	A	100	P
70	UniProt	VAR_001464	G	101	W	CDN2A_HUMAN	Disease (CMM2)	104894094	B	G	101	W
71	UniProt	VAR_015818	A	102	E	CDN2A_HUMAN	Polymorphism	137854598	B	A	102	E
72	UniProt	VAR_053031	A	102	T	CDN2A_HUMAN	Polymorphism	35741010	B	A	102	T
73	UniProt	VAR_001466	R	107	C	CDN2A_HUMAN	Disease (CMM2)	---	B	R	107	C
74	UniProt	VAR_001467	R	107	H	CDN2A_HUMAN	Polymorphism	370823171	B	R	107	H
75	UniProt	VAR_001469	D	108	H	CDN2A_HUMAN	Unclassified	---	B	D	108	H
76	UniProt	VAR_001468	D	108	Y	CDN2A_HUMAN	Unclassified	121913381	B	D	108	Y
77	UniProt	VAR_041978	D	110	N	CDK6_HUMAN	Polymorphism	35654944	A	D	110	N
78	UniProt	VAR_001470	P	114	L	CDN2A_HUMAN	Unclassified	121913386	B	P	114	L
79	UniProt	VAR_058559	P	114	S	CDN2A_HUMAN	Polymorphism	104894104	B	P	114	S
80	UniProt	VAR_001471	L	117	M	CDN2A_HUMAN	Disease (CMM2)	---	B	L	117	M
81	UniProt	VAR_001472	A	118	T	CDN2A_HUMAN	Disease (CMM2)	---	B	A	118	T
82	UniProt	VAR_001473	E	119	Q	CDN2A_HUMAN	Unclassified	---	B	E	119	Q
83	UniProt	VAR_001474	E	120	A	CDN2A_HUMAN	Unclassified	---	B	E	120	A
84	UniProt	VAR_001475	E	120	K	CDN2A_HUMAN	Unclassified	---	B	E	120	K
85	UniProt	VAR_035069	G	122	R	CDN2A_HUMAN	Disease (CMM2)	113798404	B	G	122	R
86	UniProt	VAR_001476	G	122	S	CDN2A_HUMAN	Unclassified	113798404	B	G	122	S
87	UniProt	VAR_001477	H	123	Q	CDN2A_HUMAN	Unclassified	6413463	B	H	123	Q
88	UniProt	VAR_053032	R	124	C	CDN2A_HUMAN	Polymorphism	34170727	B	R	124	C
89	UniProt	VAR_001478	R	124	H	CDN2A_HUMAN	Unclassified	747621669	B	R	124	H
90	UniProt	VAR_001479	V	126	D	CDN2A_HUMAN	Disease (CMM2)	104894098	B	V	126	D
91	UniProt	VAR_001480	A	127	S	CDN2A_HUMAN	Unclassified	6413464	B	A	127	S
92	UniProt	VAR_001481	A	132	P	CDN2A_HUMAN	Unclassified	---	B	A	132	P
93	UniProt	VAR_001482	A	134	V	CDN2A_HUMAN	Unclassified	757497674	B	A	134	V
94	UniProt	VAR_072638	A	197	T	CDK6_HUMAN	Disease (MCPH12)	606231255	A	A	197	T
95	UniProt	VAR_041979	P	199	L	CDK6_HUMAN	Unclassified	---	A	P	199	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (3, 3)

Exons (9, 9)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:269
 aligned with CDK6_HUMAN | Q00534 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:292
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299  
           CDK6_HUMAN    10 DQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ 301
               SCOP domains d1bi7a_ A: Cyclin-dependent PK, CDK6                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains -1bi7A01 A:11-102 Phosphorylase Kinase;                        domain 1                      1bi7A02 A:103-299 Transferase(Phosphotransferase) domain 1                                                                                                                                           -- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.eee..eeeeeeee.....eeeeeeee...-----------------------.......eeeeee.........eeeeee.....hhhhhhh.......hhhhhhhhhhhhhhhhhhhhh........hhh.....................................hhhhh.....hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh...............hhhh.......hhh......hhhhhhhhhh..........hhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------N--------------------------------------------------------------------------------------T-L------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ---------PROTEIN_KINASE_ATP       ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
           Transcript 1 (1) Exon 1.4b  PDB: A:10-78 (gaps) UniProt: 1-78 [INCOMPLETE]            ---------------------------------------------Exon 1.6a  PDB: A:124-179 UniProt: 124-179              Exon 1.7a  PDB: A:180-216            ----------------Exon 1.9b  PDB: A:233-278 UniProt: 233-278    Exon 1.10c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------Exon 1.5  PDB: A:78-123 UniProt: 78-123       --------------------------------------------------------------------------------------------Exon 1.8          -------------------------------------------------------------------- Transcript 1 (2)
                 1bi7 A  10 DQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQ-----------------------EHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ 301
                                    19        29        39        |-         -         -  |     79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299  
                                                                 48                      72

Chain B from PDB  Type:PROTEIN  Length:125
 aligned with CDN2A_HUMAN | P42771 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:125
                                    19        29        39        49        59        69        79        89        99       109       119       129     
          CDN2A_HUMAN    10 EPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAA 134
               SCOP domains d1bi7b_ B: Cell cycle inhibitor p16ink4A                                                                                      SCOP domains
               CATH domains 1bi7B00 B:10-134  [code=1.25.40.20, no name defined]                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhh..hhhhhhhhhh......................hhhhhhhhhh..............hhhhhhhh..hhhhhhhhhh.............hhhhhhhh..hhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) ----E-P---P--DC-D-----PD-A------------LSR--I--IVQGT-P---YRLG-KG-N--P--LL-NET-PDD---AQA-RPPLWE----CH-----L--MTQA-RQC-DS----P-V SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------S---P----------E-------------T----------V-------TK-S--V-----PT-QH--W-S--------QQP-T----HY-----S-----K-S-H---------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------Q----------V--------------------------------VV----Y--------YN--------------W----------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------------------------------------------------------------Y-------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ------ANK_REP_REGION  PDB: B:16-130 UniProt: 16-130                                                                      ---- PROSITE
               Transcript 2 Exon 2.5a  PDB: B:10-50 UniProt: 1-50    Exon 2.6c  PDB: B:51-134 UniProt: 51-153 [INCOMPLETE]                                Transcript 2
                 1bi7 B  10 EPSADWLATAAARGRVEEVRALLEAGANPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAA 134
                                    19        29        39        49        59        69        79        89        99       109       119       129

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (3, 3)

Pfam Domains (0, 0)

Gene Ontology (70, 78)

Asymmetric Unit(hide GO term definitions)

Chain A (CDK6_HUMAN | Q00534)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0030332	cyclin binding	Interacting selectively and non-covalently with cyclins, proteins whose levels in a cell varies markedly during the cell cycle, rising steadily until mitosis, then falling abruptly to zero. As cyclins reach a threshold level, they are thought to drive cells into G2 phase and thus to mitosis.
	GO:0004693	cyclin-dependent protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate. This reaction requires the binding of a regulatory cyclin subunit and full activity requires stimulatory phosphorylation by a CDK-activating kinase (CAK).
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0007219	Notch signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0033077	T cell differentiation in thymus	The process in which a precursor cell type acquires the specialized features of a T cell via a differentiation pathway dependent upon transit through the thymus.
	GO:0014002	astrocyte development	The process aimed at the progression of an astrocyte over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell. An astrocyte is the most abundant type of glial cell. Astrocytes provide support for neurons and regulate the environment in which they function.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0043697	cell dedifferentiation	The process in which a specialized cell loses the structural or functional features that characterize it in the mature organism, or some other relatively stable phase of the organism's life history. Under certain conditions, these cells can revert back to the features of the stem cells that were their ancestors.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0021542	dentate gyrus development	The process whose specific outcome is the progression of the dentate gyrus over time, from its formation to the mature structure. The dentate gyrus is one of two interlocking gyri of the hippocampus. It contains granule cells, which project to the pyramidal cells and interneurons of the CA3 region of the ammon gyrus.
	GO:0048699	generation of neurons	The process in which nerve cells are generated. This includes the production of neuroblasts and their differentiation into neurons.
	GO:0042063	gliogenesis	The process that results in the generation of glial cells. This includes the production of glial progenitors and their differentiation into mature glia.
	GO:0002244	hematopoietic progenitor cell differentiation	The process in which precursor cell type acquires the specialized features of a hematopoietic progenitor cell, a class of cell types including myeloid progenitor cells and lymphoid progenitor cells.
	GO:0060218	hematopoietic stem cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a hematopoietic stem cell. A stem cell is a cell that retains the ability to divide and proliferate throughout life to provide progenitor cells that can differentiate into specialized cells.
	GO:0030097	hemopoiesis	The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
	GO:0021670	lateral ventricle development	The process whose specific outcome is the progression of the lateral ventricles over time, from the formation to the mature structure. The two lateral ventricles are a cavity in each of the cerebral hemispheres derived from the cavity of the embryonic neural tube. They are separated from each other by the septum pellucidum, and each communicates with the third ventricle by the foramen of Monro, through which also the choroid plexuses of the lateral ventricles become continuous with that of the third ventricle.
	GO:0045786	negative regulation of cell cycle	Any process that stops, prevents or reduces the rate or extent of progression through the cell cycle.
	GO:0045596	negative regulation of cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of cell differentiation.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:2000773	negative regulation of cellular senescence	Any process that stops, prevents or reduces the frequency, rate or extent of cellular senescence.
	GO:0050680	negative regulation of epithelial cell proliferation	Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
	GO:0045638	negative regulation of myeloid cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of myeloid cell differentiation.
	GO:0045668	negative regulation of osteoblast differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of osteoblast differentiation.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0001954	positive regulation of cell-matrix adhesion	Any process that activates or increases the rate or extent of cell adhesion to an extracellular matrix.
	GO:0048146	positive regulation of fibroblast proliferation	Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:2000145	regulation of cell motility	Any process that modulates the frequency, rate or extent of cell motility.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0045646	regulation of erythrocyte differentiation	Any process that modulates the frequency, rate or extent of erythrocyte differentiation.
	GO:0010468	regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0003323	type B pancreatic cell development	The process whose specific outcome is the progression of a type B pancreatic cell over time, from its formation to the mature structure. A type B pancreatic cell is a cell located towards center of the islets of Langerhans that secretes insulin.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0000307	cyclin-dependent protein kinase holoenzyme complex	Cyclin-dependent protein kinases (CDKs) are enzyme complexes that contain a kinase catalytic subunit associated with a regulatory cyclin partner.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.

Chain B (CDN2A_HUMAN | P42771)

molecular function
	GO:0051059	NF-kappaB binding	Interacting selectively and non-covalently with NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters.
	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	Stops, prevents or reduces the activity of a cyclin-dependent protein serine/threonine kinase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0007265	Ras protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0090398	cellular senescence	A cell aging process stimulated in response to cellular stress, whereby normal cells lose the ability to divide through irreversible cell cycle arrest.
	GO:0032088	negative regulation of NF-kappaB transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor NF-kappaB.
	GO:0030308	negative regulation of cell growth	Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0001953	negative regulation of cell-matrix adhesion	Any process that stops, prevents, or reduces the rate or extent of cell adhesion to the extracellular matrix.
	GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
	GO:0042326	negative regulation of phosphorylation	Any process that stops, prevents or decreases the rate of addition of phosphate groups to a molecule.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:2000774	positive regulation of cellular senescence	Any process that activates or increases the frequency, rate or extent of cellular senescence.
	GO:2000111	positive regulation of macrophage apoptotic process	Any process that activates or increases the frequency, rate or extent of macrophage apoptotic process.
	GO:0034393	positive regulation of smooth muscle cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
	GO:0090399	replicative senescence	A cell aging process associated with the dismantling of a cell as a response to telomere shortening and/or cellular aging.
	GO:0035986	senescence-associated heterochromatin focus assembly	The assembly of chromatin into senescence-associated heterochromatin foci (SAHF), transcriptionally-silent heterochromatin structures present in senescent cells, containing the condensed chromatin of one chromosome, and enriched for histone modifications. Formation of these chromatin structures is thought to repress expression of proliferation-promoting genes.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0035985	senescence-associated heterochromatin focus	A transcriptionally-silent heterochromatin structure present in senescent cells. Contains the condensed chromatin of one chromosome and is enriched for histone modifications. Thought to repress expression of proliferation-promoting genes.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (95, 95)

PROSITE Motifs (3, 3)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (3, 3)

Pfam Domains (0, 0)

Gene Ontology (70, 78)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File