1F43 - JenaLib

Title :   SOLUTION STRUCTURE OF THE MATA1 HOMEODOMAIN

Authors :   J. S. Anderson, M. Forman, S. Modleski, F. W. Dahlquist, S. M. Baxter

Date :   07 Jun 00 (Deposition) - 26 Jul 00 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Homeodomain, Helix-Turn-Helix, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. S. Anderson, M. D. Forman, S. Modleski, F. W. Dahlquist, S. M. Baxter
Cooperative Ordering In Homeodomain-Dna Recognition: Solution Structure And Dynamics Of The Mata1 Homeodomain.
Biochemistry V. 39 10045 2000
PubMed-ID: 10955992 | Reference-DOI: 10.1021/BI000677Z
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:61
 aligned with HMRA1_YEAST | P0CY11 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:61
                                    75        85        95       105       115       125 
          HMRA1_YEAST    66 KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK 126
               SCOP domains d1f43a_ A: Mating type protein A1 Homeodomain                 SCOP domains
               CATH domains 1f43A00 A:-3-57 Homeodomain-like                              CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --HOMEOBOX_2  PDB: A:-1-57 UniProt: 68-126                    PROSITE (1)
                PROSITE (2) ------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------HOMEOBOX_1  PDB: A:34-57 PROSITE (4)
                 Transcript ------------------------------------------------------------- Transcript
                 1f43 A  -3 KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK  57
                                     6        16        26        36        46        56

Chain A from PDB  Type:PROTEIN  Length:61
 aligned with MATA1_YEASX | P0CY10 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:61
                                    75        85        95       105       115       125 
          MATA1_YEASX    66 KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK 126
               SCOP domains d1f43a_ A: Mating type protein A1 Homeodomain                 SCOP domains
               CATH domains 1f43A00 A:-3-57 Homeodomain-like                              CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --HOMEOBOX_2  PDB: A:-1-57 UniProt: 68-126                    PROSITE (2)
                PROSITE (3) -------------------------------------HOMEOBOX_1  PDB: A:34-57 PROSITE (3)
                 Transcript ------------------------------------------------------------- Transcript
                 1f43 A  -3 KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK  57
                                     6        16        26        36        46        56

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (8, 13)

NMR Structure(hide GO term definitions)

Chain A (MATA1_YEASX | P0CY10)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A (HMRA1_YEAST | P0CY11)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003714	transcription corepressor activity	Interacting selectively and non-covalently with a repressing transcription factor and also with the basal transcription machinery in order to stop, prevent, or reduce the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between repressive transcription factors and the basal transcription machinery.
biological process
	GO:1903507	negative regulation of nucleic acid-templated transcription	Any process that stops, prevents or reduces the frequency, rate or extent of nucleic acid-templated transcription.
	GO:0007532	regulation of mating-type specific transcription, DNA-templated	Any mating-type specific process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1f43)

	Sites
(no "Sites" information available for 1f43)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1f43)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1f43
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HMRA1_YEAST \| P0CY11
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	MATA1_YEASX \| P0CY10
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HMRA1_YEAST \| P0CY11
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	MATA1_YEASX \| P0CY10
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description