Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  DIHYDROLIPOAMIDE DEHYDROGENASE COMPLEXED WITH THE BINDING DOMAIN OF THE DIHYDROLIPOAMIDE ACETYLASE
 
Authors :  S. S. Mande, S. Sarfaty, M. D. Allen, R. N. Perham, W. G. J. Hol
Date :  03 Feb 96  (Deposition) - 11 Jul 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Redox-Active Center, Glycolysis, Oxidoreductase, Complex (Oxidoreductase/Transferase) Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. S. Mande, S. Sarfaty, M. D. Allen, R. N. Perham, W. G. Hol
Protein-Protein Interactions In The Pyruvate Dehydrogenase Multienzyme Complex: Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of Dihydrolipoamide Acetyltransferase.
Structure V. 4 277 1996
PubMed-ID: 8805537  |  Reference-DOI: 10.1016/S0969-2126(96)00032-9
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DIHYDROLIPOAMIDE DEHYDROGENASE
    Chains: A, B
    EC Number: 1.8.1.4
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: GEOBACILLUS STEAROTHERMOPHILUS
    Organism Taxid: 1422
    Synonym: E3BD
 
Molecule 2 - DIHYDROLIPOAMIDE ACETYLTRANSFERASE
    Chains: C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: BINDING DOMAIN, RESIDUES 130 - 170
    Organism Scientific: GEOBACILLUS STEAROTHERMOPHILUS
    Organism Taxid: 1422

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:16 , GLY A:18 , PRO A:19 , GLY A:20 , VAL A:38 , GLU A:39 , LYS A:40 , GLY A:45 , VAL A:46 , CYS A:47 , VAL A:50 , GLY A:51 , CYS A:52 , LYS A:56 , GLY A:117 , GLU A:118 , ALA A:119 , ALA A:146 , THR A:147 , GLY A:148 , TYR A:186 , ILE A:187 , ARG A:274 , GLY A:313 , ASP A:314 , ALA A:320 , LEU A:321 , ALA A:322 , HOH A:470 , HOH A:478 , HIS B:446 , PRO B:447BINDING SITE FOR RESIDUE FAD A 462
2AC2SOFTWAREHIS A:446 , PRO A:447 , GLY B:16 , GLY B:18 , PRO B:19 , GLY B:20 , GLU B:39 , LYS B:40 , GLY B:45 , VAL B:46 , CYS B:47 , CYS B:52 , LYS B:56 , GLY B:117 , GLU B:118 , ALA B:119 , ALA B:146 , THR B:147 , GLY B:148 , TYR B:186 , ILE B:187 , ARG B:274 , GLY B:313 , ASP B:314 , ALA B:320 , LEU B:321 , ALA B:322 , HOH B:463 , HOH B:478BINDING SITE FOR RESIDUE FAD B 462

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:47 -A:52

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1His A:446 -Pro A:447
2His B:446 -Pro B:447

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EBD)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PYRIDINE_REDOX_1PS00076 Pyridine nucleotide-disulphide oxidoreductases class-I active site.DLDH1_GEOSE44-54
 		  2A:44-54
B:44-54
2PSBDPS51826 Peripheral subunit-binding (PSBD) domain profile.ODP2_GEOSE130-167  1C:130-167

(-) Exons   (0, 0)

(no "Exon" information available for 1EBD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:455
 aligned with DLDH1_GEOSE | P11959 from UniProtKB/Swiss-Prot  Length:470

    Alignment length:455
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456     
          DLDH1_GEOSE     7 AIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIELPNFKFSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAAEAIAGHPSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVAL 461
               SCOP domains d1ebda1 A:7-154,A:272-346 Dihydrolipoamide dehydrogenase                                                                                            d1ebda2 A:155-271 Dihydrolipoamide dehydrogenase                                                                     d1ebda1 A:7-154,A:272-346 Dihydrolipoamide dehydrogenase                   d1ebda3 A:347-461 Dihydrolipoamide dehydrogenase                                                                    SCOP domains
               CATH domains 1ebdA01 A:7-151,A:273-346  [code=3.50.50.60, no name defined]                                                                                    1ebdA02 A:152-272  [code=3.50.50.60, no name defined]                                                                    1ebdA01 A:7-151,A:273-346  [code=3.50.50.60, no name defined]             1ebdA03 A:347-461  [code=3.30.390.30, no name defined]                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.eeee...hhhhhhhhhhhh....eeeee.....hhhhh..hhhhhhhhhhhhhhhhhh..hhh..........hhhhhhhhhhhhhhhhhhhhhhhhhh..eeee.eeeeee..eeeeee..eeeeeee.eeee...eee..............hhhhh.......eeeee...hhhhhhhhhhhh...eeeeee..........hhhhhhhhhhhhh...eeee.eeeeeeeee..eeeeeeee..eeeeeee.eeee...eee................................eee.hhh......hhhhhhhhhhhhhhh.............eee.....eeeee..hhhhh.....eeeeeeehhh.hhhhhh.....eeeeeee....eeeeeeee...hhhhhhhhhhhhhh...hhhhhh........hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------PYRIDINE_RE----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ebd A   7 AIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIELPNFKFSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAAEAIAGHPSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVAL 461
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456     


Chain B from PDB  Type:PROTEIN  Length:455
 aligned with DLDH1_GEOSE | P11959 from UniProtKB/Swiss-Prot  Length:470

    Alignment length:455
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456     
          DLDH1_GEOSE     7 AIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIELPNFKFSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAAEAIAGHPSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVAL 461
               SCOP domains d1ebdb1 B:7-154,B:272-346 Dihydrolipoamide dehydrogenase                                                                                            d1ebdb2 B:155-271 Dihydrolipoamide dehydrogenase                                                                     d1ebdb1 B:7-154,B:272-346 Dihydrolipoamide dehydrogenase                   d1ebdb3 B:347-461 Dihydrolipoamide dehydrogenase                                                                    SCOP domains
               CATH domains 1ebdB01 B:7-151,B:273-346  [code=3.50.50.60, no name defined]                                                                                    1ebdB02 B:152-272  [code=3.50.50.60, no name defined]                                                                    1ebdB01 B:7-151,B:273-346  [code=3.50.50.60, no name defined]             1ebdB03 B:347-461  [code=3.30.390.30, no name defined]                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee...hhhhhhhhhhhh....eeeee.....hhhhhh.hhhhhhhhhhhhhhhhhhh.hhh..........hhhhhhhhhhhhhhhhhhhhhhhhh...eeee.eeeeee..eeeeee..eeeeee..eeee...eee..............hhhhh.......eeeee...hhhhhhhhhhhhh..eeeee...........hhhhhhhhhhhhhh..eee..eeeeeeee....eeeeeee..eeeeeee.eeee...eee......hhhh......................eee.hhh......hhhhhhhhhhhhhhhh............eee.....eeeee..hhhhhhh...eeeeeee....hhhhhh.....eeeeeee....eeeeeeee...hhhhhhhhhhhhhh...hhhhh.........hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------PYRIDINE_RE----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ebd B   7 AIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIELPNFKFSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAAEAIAGHPSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVAL 461
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456     


Chain C from PDB  Type:PROTEIN  Length:41
 aligned with ODP2_GEOSE | P11961 from UniProtKB/Swiss-Prot  Length:428

    Alignment length:41
                                   139       149       159       169 
           ODP2_GEOSE   130 IAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGG 170
               SCOP domains d1ebdc_ C:                                SCOP domains
               CATH domains 1ebdC00 C:130-170                         CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhh...........hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE PSBD  PDB: C:130-167 UniProt: 130-167 --- PROSITE
                 Transcript ----------------------------------------- Transcript
                 1ebd C 130 IAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGG 170
                                   139       149       159       169
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 7)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (3, 7)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Few Secondary Structures (1120)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EBD)

(-) Gene Ontology  (12, 13)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (DLDH1_GEOSE | P11959)
molecular function
    GO:0004148    dihydrolipoyl dehydrogenase activity    Catalysis of the reaction: protein N6-(dihydrolipoyl)lysine + NAD+ = protein N6-(lipoyl)lysine + NADH + H+.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016668    oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a sulfur-containing group acts as a hydrogen or electron donor and reduces NAD or NADP.
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain C   (ODP2_GEOSE | P11961)
molecular function
    GO:0004742    dihydrolipoyllysine-residue acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + dihydrolipoamide = CoA + S-acetyldihydrolipoamide.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:446 - Pro A:447   [ RasMol ]  
    His B:446 - Pro B:447   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ebd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DLDH1_GEOSE | P11959
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  ODP2_GEOSE | P11961
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.8.1.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DLDH1_GEOSE | P11959
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ODP2_GEOSE | P11961
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ODP2_GEOSE | P11961: 1b5s 1lab 1lac 1w3d 1w4e 1w4f 1w4g 1w4h 1w85 1w88 2pdd 2pde 3duf 3dv0 3dva

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1EBD)