|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 4)
|
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1Z3L) |
Asymmetric Unit (1, 1)
|
Asymmetric Unit (1, 2)
|
Asymmetric UnitChain E from PDB Type:PROTEIN Length:104 aligned with RNAS1_BOVIN | P61823 from UniProtKB/Swiss-Prot Length:150 Alignment length:104 56 66 76 86 96 106 116 126 136 146 RNAS1_BOVIN 47 SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 150 SCOP domains d1z3l.1 S:,E: Ribonuclease A (also ribonuclease B, S) SCOP domains CATH domains 1z3lE00 E:21-124 P-30 Protein CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------RNASE_P------------------------------------------------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: E:21-124 UniProt: 1-159 [INCOMPLETE] Transcript 1 1z3l E 21 SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 124 30 40 50 60 70 80 90 100 110 120 Chain S from PDB Type:PROTEIN Length:15 aligned with RNAS1_BOVIN | P61823 from UniProtKB/Swiss-Prot Length:150 Alignment length:15 36 RNAS1_BOVIN 27 KETAAAKFERQHMDS 41 SCOP domains d1z3l.1 S:,E: SCOP domains CATH domains --------------- CATH domains Pfam domains (1) RnaseA-1z3lS01 Pfam domains (1) Pfam domains (2) RnaseA-1z3lS02 Pfam domains (2) SAPs(SNPs) --------------- SAPs(SNPs) PROSITE --------------- PROSITE Transcript 1 Exon 1.2 Transcript 1 1z3l S 1 KETAAAKaERQHlDS 15 |10 | 8-ABA| 13-NLE
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain E,S (RNAS1_BOVIN | P61823)
|
|
|
|
|
|
|