3I6F - JenaLib

Asymmetric Unit

Asym. Unit - sites

Biological Unit 1

Biol. Unit 1 - sites

collapse

expand

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Description

Title :   RIBONUCLEASE A BY CLASSICAL HANGING DROP METHOD BEFORE HIGH X-RAY DOSE ON ESRF ID14-2 BEAMLINE

Authors :   E. Pechkova, S. K. Tripathi, R. Ravelli, S. Mcsweeney, C. Nicolini

Date :   07 Jul 09 (Deposition) - 07 Jul 10 (Release) - 07 Jul 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.30

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Ribonuclease A, Disulfide Bond, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Pechkova, S. Mcsweeney, C. Nicolini
Atomic Structure And Radiation Resistance Of Langmuir-Blodgett Protein Crystals
To Be Published
PubMed: search

Compounds

Molecule 1 - RIBONUCLEASE PANCREATIC
	Chains	:	A
	EC Number	:	3.1.27.5
	Organism Common	:	BOVINE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	RNASE 1, RNASE A
	Tissue	:	PANCREAS

Structural Features

Chains, Units

		1
Asymmetric Unit	:	A
Biological Unit 1 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (1, 1)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	CL	1	Ligand/Ion	CHLORIDE ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION

Sites (1, 1)

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:12 , ASN A:44 , THR A:45 , HOH A:157 , HOH A:183 , HOH A:270	BINDING SITE FOR RESIDUE CL A 1125

SS Bonds (4, 4)

Asymmetric Unit

No.	Residues
1	A:26	-	A:84
2	A:40	-	A:95
3	A:58	-	A:110
4	A:65	-	A:72

Cis Peptide Bonds (2, 2)

Asymmetric Unit

No.	Residues
1	Tyr A:92	-	Pro A:93
2	Asn A:113	-	Pro A:114

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 3I6F)

PROSITE Motifs (1, 1)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RNASE_PANCREATIC	PS00127	Pancreatic ribonuclease family signature.	RNAS1_BOVIN	66-72	1	A:40-46

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RNASE_PANCREATIC	PS00127	Pancreatic ribonuclease family signature.	RNAS1_BOVIN	66-72	2	A:40-46

Exons (1, 1)

Asymmetric Unit (1, 1)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000011586	1	ENSBTAE00000400684	chr10:25757929-25757973	45	RNAS1_BOVIN	-	0	0	-	-
1.2	ENSBTAT00000011586	2	ENSBTAE00000093931	chr10:25758709-25759510	802	RNAS1_BOVIN	1-159	159	1	A:1-124	124

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:124
 aligned with RNAS1_BOVIN | P61823 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:124
                                    36        46        56        66        76        86        96       106       116       126       136       146    
          RNAS1_BOVIN    27 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 150
               SCOP domains d3i6fa_ A: automated matches                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh..........hhhhhhhhhh.........eeeee..hhhhhhhhhhheee........eee....eeeeeeee..........eeeeeeeeeeeeeee....eeeeeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------RNASE_P------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.2  PDB: A:1-124 UniProt: 1-159 [INCOMPLETE]                                                                           Transcript 1
                 3i6f A   1 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 124
                                    10        20        30        40        50        60        70        80        90       100       110       120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: RNase A-like (356)

Superfamily: RNase A-like (356)

Family: Ribonuclease A-like (347)

Protein domain: automated matches (86)

Cow (Bos taurus) [TaxId: 9913] (70)

d3i6fa_

CATH Domains (0, 0)

(no "CATH Domain" information available for 3I6F)

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 3I6F)

Gene Ontology (9, 9)

Asymmetric Unit(hide GO term definitions)

Chain A (RNAS1_BOVIN | P61823)

molecular function
	GO:0004519	endonuclease activity	Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004518	nuclease activity	Catalysis of the hydrolysis of ester linkages within nucleic acids.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004522	ribonuclease A activity	Catalysis of the endonucleolytic cleavage of RNA to 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates.
biological process
	GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
	GO:0090305	nucleic acid phosphodiester bond hydrolysis	The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:113 - Pro A:114	[ RasMol ]
		Tyr A:92 - Pro A:93	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3i6f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RNAS1_BOVIN \| P61823
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.27.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RNAS1_BOVIN \| P61823
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	RNAS1_BOVIN \| P61823	:	1a2w 1a5p 1a5q 1afk 1afl 1afu 1aqp 1b6v 1bel 1bzq 1c0b 1c0c 1c8w 1c9v 1c9x 1cjq 1cjr 1d5d 1d5e 1d5h 1dfj 1dy5 1eic 1eid 1eie 1eos 1eow 1f0v 1fev 1fs3 1gv7 1izp 1izq 1izr 1j7z 1j80 1j81 1j82 1jn4 1js0 1jvt 1jvu 1jvv 1kf2 1kf3 1kf4 1kf5 1kf7 1kf8 1kh8 1lsq 1o0f 1o0h 1o0m 1o0n 1o0o 1qhc 1rar 1ras 1rat 1rbb 1rbc 1rbd 1rbe 1rbf 1rbg 1rbh 1rbi 1rbj 1rbn 1rbw 1rbx 1rca 1rcn 1rha 1rhb 1rnc 1rnd 1rnm 1rnn 1rno 1rnq 1rnu 1rnv 1rnw 1rnx 1rny 1rnz 1rob 1rpf 1rpg 1rph 1rsm 1rta 1rtb 1ruv 1srn 1ssa 1ssb 1ssc 1u1b 1un5 1w4o 1w4p 1w4q 1wbu 1xps 1xpt 1ymn 1ymr 1ymw 1z3l 1z3m 1z3p 1z6d 1z6s 2aas 2apq 2apu 2blp 2blz 2e33 2e3w 2g4w 2g4x 2g8q 2g8r 2nui 2op2 2oqf 2p42 2p43 2p44 2p45 2p46 2p47 2p48 2p49 2p4a 2qca 2rat 2rln 2rns 2w5g 2w5i 2w5k 2w5l 2w5m 2xog 2xoi 3a1r 3d6o 3d6p 3d6q 3d7b 3d8y 3d8z 3dh5 3dh6 3di7 3di8 3di9 3dib 3dic 3dxg 3dxh 3eux 3euy 3euz 3ev0 3ev1 3ev2 3ev3 3ev4 3ev5 3ev6 3fkz 3fl0 3fl1 3fl3 3i67 3i6h 3i6j 3i7w 3i7x 3i7y 3jw1 3lxo 3mwq 3mwr 3mx8 3mzq 3mzr 3oqy 3oqz 3or0 3ql1 3ql2 3qsk 3rat 3rh1 3rid 3rn3 3rsd 3rsk 3rsp 3srn 4ao1 4g8v 4g8y 4g90 4j5z 4j60 4j61 4j62 4j63 4j64 4j65 4j66 4j67 4j68 4j69 4j6a 4k7l 4k7m 4l55 4mxf 4o36 4o37 4okf 4ooh 4ot4 4peq 4pou 4qh3 4rat 4rsd 4rsk 4rte 4s0q 4s18 4srn 4wyn 4wyp 4wyz 4ygw 4zz4 5d6u 5d97 5e5e 5e5f 5et4 5jlg 5jmg 5jml 5rat 5rsa 6rat 6rsa 7rat 7rsa 8rat 8rsa 9rat 9rsa

Related Entries Specified in the PDB File

3i67	RIBONUCLEASE A
3i6h
3i6j