|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 2) Biological Unit 1 (2, 2) Biological Unit 2 (2, 4) |
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1RBE) |
Asymmetric Unit (1, 1)
|
Asymmetric Unit (1, 2)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:104 aligned with RNAS1_BOVIN | P61823 from UniProtKB/Swiss-Prot Length:150 Alignment length:104 56 66 76 86 96 106 116 126 136 146 RNAS1_BOVIN 47 SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 150 SCOP domains d1rbe.1 S:,A: Ribonuclease A (also ribonuclease B, S) SCOP domains CATH domains 1rbeA00 A:21-124 P-30 Protein CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------RNASE_P------------------------------------------------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: A:21-124 UniProt: 1-159 [INCOMPLETE] Transcript 1 1rbe A 21 SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 124 30 40 50 60 70 80 90 100 110 120 Chain S from PDB Type:PROTEIN Length:16 aligned with RNAS1_BOVIN | P61823 from UniProtKB/Swiss-Prot Length:150 Alignment length:16 36 RNAS1_BOVIN 27 KETAAAKFERQHMDSS 42 SCOP domains d1rbe.1 S:,A: SCOP domains CATH domains ---------------- CATH domains Pfam domains (1) RnaseA-1rbeS01 - Pfam domains (1) Pfam domains (2) RnaseA-1rbeS02 - Pfam domains (2) SAPs(SNPs) ---------------- SAPs(SNPs) PROSITE ---------------- PROSITE Transcript 1 Exon 1.2 Transcript 1 1rbe S 1 KETAAAKFERQHFDSx 16 10 | 16-NH2
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,S (RNAS1_BOVIN | P61823)
|
|
|
|
|
|
|