Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF THE HOMEODOMAIN OF PITX2 IN COMPLEX WITH A TAATCC DNA BINDING SITE
 
Authors :  J. M. Baird-Titus, T. Doerdelmann, B. A. Chaney, K. Clark-Baldwin, V. D
Date :  21 Oct 11  (Deposition) - 02 May 12  (Release) - 02 May 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C  (17x)
NMR Structure *:  A,B,C  (1x)
Keywords :  Transcription-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. A. Chaney, K. Clark-Baldwin, V. Dave, J. Ma, M. Rance
Solution Structure Of The K50 Class Homeodomain Pitx2 Bound To Dna And Implications For Mutations That Cause Rieger Syndrome
Biochemistry V. 44 7497 2005
PubMed-ID: 15895993  |  Reference-DOI: 10.1021/BI0473253

(-) Compounds

Molecule 1 - PITUITARY HOMEOBOX 3
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPGEX-1LAMBDAT-PITX2HD
    FragmentHOMEOBOX DNA BINDING DOMAIN RESIDUES 62-121
    GenePITX3, PTX3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymHOMEOBOX PROTEIN PITX3, PAIRED-LIKE HOMEODOMAIN TRANSCRIPTION FACTOR 3
 
Molecule 2 - DNA (5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3')
    ChainsB
    EngineeredYES
    SyntheticYES
 
Molecule 3 - DNA (5'-D(*CP*GP*GP*GP*GP*AP*TP*TP*AP*GP*AP*GP*C)-3')
    ChainsC
    EngineeredYES
    SyntheticYES

 Structural Features

(-) Chains, Units

  123
NMR Structure (17x)ABC
NMR Structure * (1x)ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LKX)

(-) Sites  (0, 0)

(no "Site" information available for 2LKX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LKX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LKX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (13, 13)

NMR Structure (13, 13)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_003763L100QPITX2_HUMANDisease (RIEG1)104893857AL16Q
02UniProtVAR_035027R108HPITX2_HUMANDisease (RDC)104893862AR24H
03UniProtVAR_058735P110LPITX2_HUMANDisease (RIEG1)1057519484AP26L
04UniProtVAR_058736P110RPITX2_HUMANDisease (RIEG1)  ---AP26R
05UniProtVAR_003764T114PPITX2_HUMANDisease (RIEG1)104893858AT30P
06UniProtVAR_003765R115HPITX2_HUMANDisease (ASGD4)104893861AR31H
07UniProtVAR_035029V129LPITX2_HUMANDisease (RIEG1)121909249AV45L
08UniProtVAR_003762R130WPITX2_HUMANDisease (ASGD4)121909248AR46W
09UniProtVAR_058737K134EPITX2_HUMANDisease (RIEG1)387906810AK50E
10UniProtVAR_058738R136CPITX2_HUMANDisease (RIEG1)  ---AR52C
11UniProtVAR_003766R137PPITX2_HUMANDisease (RIEG1)104893859AR53P
12UniProtVAR_058739L151VPITX2_HUMANDisease (RIEG1)  ---AF62V
13UniProtVAR_058740N154TPITX2_HUMANDisease (RIEG1)  ---AT65T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
NMR Structure * (13, 13)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_003763L100QPITX2_HUMANDisease (RIEG1)104893857AL16Q
02UniProtVAR_035027R108HPITX2_HUMANDisease (RDC)104893862AR24H
03UniProtVAR_058735P110LPITX2_HUMANDisease (RIEG1)1057519484AP26L
04UniProtVAR_058736P110RPITX2_HUMANDisease (RIEG1)  ---AP26R
05UniProtVAR_003764T114PPITX2_HUMANDisease (RIEG1)104893858AT30P
06UniProtVAR_003765R115HPITX2_HUMANDisease (ASGD4)104893861AR31H
07UniProtVAR_035029V129LPITX2_HUMANDisease (RIEG1)121909249AV45L
08UniProtVAR_003762R130WPITX2_HUMANDisease (ASGD4)121909248AR46W
09UniProtVAR_058737K134EPITX2_HUMANDisease (RIEG1)387906810AK50E
10UniProtVAR_058738R136CPITX2_HUMANDisease (RIEG1)  ---AR52C
11UniProtVAR_003766R137PPITX2_HUMANDisease (RIEG1)104893859AR53P
12UniProtVAR_058739L151VPITX2_HUMANDisease (RIEG1)  ---AF62V
13UniProtVAR_058740N154TPITX2_HUMANDisease (RIEG1)  ---AT65T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HOMEOBOX_2PS50071 'Homeobox' domain profile.PITX3_HUMAN60-120  1A:1-59
PITX2_HUMAN83-143  1A:1-59
2HOMEOBOX_1PS00027 'Homeobox' domain signature.PITX3_HUMAN95-118  1A:34-57
PITX2_HUMAN118-141  1A:34-57
NMR Structure * (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HOMEOBOX_2PS50071 'Homeobox' domain profile.PITX3_HUMAN60-120  1A:1-59
PITX2_HUMAN83-143  1A:1-59
2HOMEOBOX_1PS00027 'Homeobox' domain signature.PITX3_HUMAN95-118  1A:34-57
PITX2_HUMAN118-141  1A:34-57

(-) Exons   (0, 0)

(no "Exon" information available for 2LKX)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:68
 aligned with PITX2_HUMAN | Q99697 from UniProtKB/Swiss-Prot  Length:317

    Alignment length:87
                                    78        88        98       108       118       128       138       148       
          PITX2_HUMAN    69 GKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG 155
               SCOP domains ----------------d2lkxa1 A:1-60 Pituitary homeobox 2                         ----------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..--------------........hhhhhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh-----h..... Sec.struct. author
             SAPs(SNPs) (1) -------------------------------Q-------H-L---PH-------------LW---E-CP-------------V--T- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------R--------------------------------------------- SAPs(SNPs) (2)
                PROSITE (2) --------------HOMEOBOX_2  PDB: A:1-59 UniProt: 83-143                      ------------ PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------HOMEOBOX_1  PDB: A:34-57-------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------- Transcript
                 2lkx A  -2 GS--------------QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRE-----EFIVTD  66
                             |       -      |  4        14        24        34        44        54     |   - |     
                             |              1                                                         60    61     
                            -1                                                                                     

Chain A from PDB  Type:PROTEIN  Length:68
 aligned with PITX3_HUMAN | O75364 from UniProtKB/Swiss-Prot  Length:302

    Alignment length:77
                                    60        70        80        90       100       110       120       
          PITX3_HUMAN    51 GSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAE 127
               SCOP domains -----------d2lkxa1 A:1-60 Pituitary homeobox 2                         ------ SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..---------........hhhhhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
             SAPs(SNPs) (1) --------------------------Q-------H-L---PH-------------LW---E-CP--------V--T- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------R---------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) ---------HOMEOBOX_2  PDB: A:1-59 UniProt: 60-120                      ------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------HOMEOBOX_1  PDB: A:34-57--------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------- Transcript
                 2lkx A  -2 GS---------QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD  66
                             |       - |       9        19        29        39        49        59       
                            -1         1                                                                 

Chain B from PDB  Type:DNA  Length:13
                                             
                 2lkx B  67 GCTCTAATCCCCG  79
                                    76   

Chain C from PDB  Type:DNA  Length:13
                                             
                 2lkx C  80 CGGGGATTAGAGC  92
                                    89   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0 ; only for superseded entry 1YZ8: 1,1)

(no "CATH Domain" information available for 2LKX, only for superseded entry 1YZ8 replaced by 2LKX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LKX)

(-) Gene Ontology  (92, 104)

NMR Structure(hide GO term definitions)
Chain A   (PITX2_HUMAN | Q99697)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003700    DNA-binding transcription factor activity    A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
    GO:0000981    DNA-binding transcription factor activity, RNA polymerase II-specific    A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a RNA polymerase II-transcribed gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units.
    GO:0001102    RNA polymerase II activating transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
    GO:0000978    RNA polymerase II proximal promoter sequence-specific DNA binding    Interacting selectively and non-covalently with a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site) located in the proximal promoter of a gene transcribed by RNA polymerase II. The proximal promoter is in cis with and relatively close to the core promoter.
    GO:0001085    RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
    GO:0031490    chromatin DNA binding    Interacting selectively and non-covalently with DNA that is assembled into chromatin.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0001191    obsolete transcriptional repressor activity, RNA polymerase II transcription factor binding    OBSOLETE. Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
    GO:0051219    phosphoprotein binding    Interacting selectively and non-covalently with a phosphorylated protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0001077    proximal promoter DNA-binding transcription activator activity, RNA polymerase II-specific    A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within a proximal promoter regulatory region of a RNA polymerase II-transcribed gene to activate or increase transcription.
    GO:0001078    proximal promoter DNA-binding transcription repressor activity, RNA polymerase II-specific    A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within a proximal promoter regulatory region of a RNA polymerase II-transcribed gene to repress or decrease transcription.
    GO:0043021    ribonucleoprotein complex binding    Interacting selectively and non-covalently with any complex of RNA and protein.
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0000976    transcription regulatory region sequence-specific DNA binding    Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0009653    anatomical structure morphogenesis    The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0055009    atrial cardiac muscle tissue morphogenesis    The process in which the anatomical structure of cardiac atrium muscle is generated and organized.
    GO:0003171    atrioventricular valve development    The progression of the atrioventricular valve over time, from its formation to the mature structure.
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:0001569    branching involved in blood vessel morphogenesis    The process of coordinated growth and sprouting of blood vessels giving rise to the organized vascular system.
    GO:0043010    camera-type eye development    The process whose specific outcome is the progression of the camera-type eye over time, from its formation to the mature structure. The camera-type eye is an organ of sight that receives light through an aperture and focuses it through a lens, projecting it on a photoreceptor field.
    GO:0055007    cardiac muscle cell differentiation    The process in which a cardiac muscle precursor cell acquires specialized features of a cardiac muscle cell. Cardiac muscle cells are striated muscle cells that are responsible for heart contraction.
    GO:0048738    cardiac muscle tissue development    The process whose specific outcome is the progression of cardiac muscle over time, from its formation to the mature structure.
    GO:0003253    cardiac neural crest cell migration involved in outflow tract morphogenesis    The orderly movement of a neural crest cell from one site to another that will contribute to the morphogenesis of the outflow tract.
    GO:0061325    cell proliferation involved in outflow tract morphogenesis    The multiplication or reproduction of cells, resulting in the expansion of a cell population that contributes to the shaping of the outflow tract.
    GO:0035993    deltoid tuberosity development    The process whose specific outcome is the progression of the deltoid tuberosity over time, from its formation to the mature structure. The deltoid tuberosity is the region on the shaft of the humerus to which the deltoid muscle attaches. The deltoid tuberosity develops through endochondral ossification in a two-phase process; an initiating tendon-dependent phase, and a muscle-dependent growth phase.
    GO:0007368    determination of left/right symmetry    The establishment of an organism's body plan or part of an organism with respect to the left and right halves. The pattern can either be symmetric, such that the halves are mirror images, or asymmetric where the pattern deviates from this symmetry.
    GO:0055123    digestive system development    The process whose specific outcome is the progression of the digestive system over time, from its formation to the mature structure. The digestive system is the entire structure in which digestion takes place. Digestion is all of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0031076    embryonic camera-type eye development    The process occurring during the embryonic phase whose specific outcome is the progression of the eye over time, from its formation to the mature structure.
    GO:0048557    embryonic digestive tract morphogenesis    The process in which the anatomical structures of the digestive tract are generated and organized during embryonic development. The digestive tract is the anatomical structure through which food passes and is processed.
    GO:0035116    embryonic hindlimb morphogenesis    The process, occurring in the embryo, by which the anatomical structures of the hindlimbs are generated and organized. The hindlimbs are the posterior limbs of an animal.
    GO:0061031    endodermal digestive tract morphogenesis    The process in which the anatomical structures of the endodermal digestive tract are generated and organized. The endodermal digestive tract includes those portions of the digestive tract that are derived from endoderm.
    GO:0002074    extraocular skeletal muscle development    The process whose specific outcome is the progression of the extraocular skeletal muscle over time, from its formation to the mature structure. The extraocular muscle is derived from cranial mesoderm and controls eye movements. The muscle begins its development with the differentiation of the muscle cells and ends with the mature muscle. An example of this process is found in Mus musculus.
    GO:0008585    female gonad development    The process whose specific outcome is the progression of the female gonad over time, from its formation to the mature structure.
    GO:0035315    hair cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a hair cell.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0021855    hypothalamus cell migration    The directed movement of a cell into the hypothalamus region of the forebrain.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0061072    iris morphogenesis    The process in which the iris is generated and organized. The iris is an anatomical structure in the eye whose opening forms the pupil. The iris is responsible for controlling the diameter and size of the pupil and the amount of light reaching the retina.
    GO:0060460    left lung morphogenesis    The process in which anatomical structures of the left lung are generated and organized.
    GO:0070986    left/right axis specification    The establishment, maintenance and elaboration of the left/right axis. The left/right axis is defined by a line that runs orthogonal to both the anterior/posterior and dorsal/ventral axes. Each side is defined from the viewpoint of the organism rather of the observer (as per anatomical axes).
    GO:0030324    lung development    The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0007520    myoblast fusion    A process in which non-proliferating myoblasts fuse to existing fibers or to myotubes to form new fibers. A myoblast is a mononucleate cell type that, by fusion with other myoblasts, gives rise to the myotubes that eventually develop into skeletal muscle fibers.
    GO:0000122    negative regulation of transcription by RNA polymerase II    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription mediated by RNA polymerase II.
    GO:0030182    neuron differentiation    The process in which a relatively unspecialized cell acquires specialized features of a neuron.
    GO:0001764    neuron migration    The characteristic movement of an immature neuron from germinal zones to specific positions where they will reside as they mature.
    GO:0042476    odontogenesis    The process whose specific outcome is the progression of a tooth or teeth over time, from formation to the mature structure(s). A tooth is any hard bony, calcareous, or chitinous organ found in the mouth or pharynx of an animal and used in procuring or masticating food.
    GO:0042475    odontogenesis of dentin-containing tooth    The process whose specific outcome is the progression of a dentin-containing tooth over time, from its formation to the mature structure. A dentin-containing tooth is a hard, bony organ borne on the jaw or other bone of a vertebrate, and is composed mainly of dentin, a dense calcified substance, covered by a layer of enamel.
    GO:0021983    pituitary gland development    The progression of the pituitary gland over time from its initial formation until its mature state. The pituitary gland is an endocrine gland that secretes hormones that regulate many other glands.
    GO:0043388    positive regulation of DNA binding    Any process that increases the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:2000288    positive regulation of myoblast proliferation    Any process that activates or increases the frequency, rate or extent of myoblast proliferation.
    GO:0045944    positive regulation of transcription by RNA polymerase II    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0060127    prolactin secreting cell differentiation    The process in which a relatively unspecialized cell acquires specialized structural and/or functional features of a prolactin secreting cell. A prolactin secreting cell is an acidophilic cell of the anterior pituitary that produces prolactin.
    GO:0003350    pulmonary myocardium development    The progression of the pulmonary myocardium over time, from its initial formation to the mature structure. The pulmonary myocardium is the myocardial tissue present in the pulmonary vein.
    GO:0060577    pulmonary vein morphogenesis    The process in which the anatomical structure of the pulmonary venous blood vessels are generated and organized. Pulmonary veins are blood vessels that transport blood from the lungs to the heart.
    GO:0030334    regulation of cell migration    Any process that modulates the frequency, rate or extent of cell migration.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0006357    regulation of transcription by RNA polymerase II    Any process that modulates the frequency, rate or extent of transcription mediated by RNA polymerase II.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0009725    response to hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
    GO:0033189    response to vitamin A    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin A stimulus.
    GO:0007519    skeletal muscle tissue development    The developmental sequence of events leading to the formation of adult skeletal muscle tissue. The main events are: the fusion of myoblasts to form myotubes that increase in size by further fusion to them of myoblasts, the formation of myofibrils within their cytoplasm and the establishment of functional neuromuscular junctions with motor neurons. At this stage they can be regarded as mature muscle fibers.
    GO:0060126    somatotropin secreting cell differentiation    The process in which a relatively unspecialized cell acquires specialized structural and/or functional features of a somatotropin secreting cell. A somatotropin secreting cell is an acidophilic cell of the anterior pituitary that produces growth hormone, somatotropin.
    GO:0048536    spleen development    The process whose specific outcome is the progression of the spleen over time, from its formation to the mature structure. The spleen is a large vascular lymphatic organ composed of white and red pulp, involved both in hemopoietic and immune system functions.
    GO:0021763    subthalamic nucleus development    The progression of the subthalamic nucleus over time from its initial formation until its mature state. The subthalamic nucleus is the lens-shaped nucleus located in the ventral part of the subthalamus on the inner aspect of the internal capsule that is concerned with the integration of somatic motor function.
    GO:0060578    superior vena cava morphogenesis    The process in which the anatomical structure of superior vena cava generated and organized. The superior vena cava is a blood vessel that transports blood from the upper body to the heart.
    GO:0006366    transcription by RNA polymerase II    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0035886    vascular smooth muscle cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a vascular smooth muscle cell.
    GO:0001570    vasculogenesis    The differentiation of endothelial cells from progenitor cells during blood vessel development, and the de novo formation of blood vessels and tubes.
    GO:0055015    ventricular cardiac muscle cell development    The process whose specific outcome is the progression of a ventricular cardiac muscle cell over time, from its formation to the mature state. Cardiac muscle cells are striated muscle cells that are responsible for heart contraction. The ventricle is the part of the heart that pumps blood out of the organ.
    GO:0060412    ventricular septum morphogenesis    The developmental process in which a ventricular septum is generated and organized. A ventricular septum is an anatomical structure that separates the lower chambers (ventricles) of the heart from one another.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005667    transcription factor complex    A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Chain A   (PITX3_HUMAN | O75364)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003700    DNA-binding transcription factor activity    A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
    GO:0000978    RNA polymerase II proximal promoter sequence-specific DNA binding    Interacting selectively and non-covalently with a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site) located in the proximal promoter of a gene transcribed by RNA polymerase II. The proximal promoter is in cis with and relatively close to the core promoter.
    GO:0001077    proximal promoter DNA-binding transcription activator activity, RNA polymerase II-specific    A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within a proximal promoter regulatory region of a RNA polymerase II-transcribed gene to activate or increase transcription.
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
biological process
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0071542    dopaminergic neuron differentiation    The process in which a neuroblast acquires the specialized structural and functional features of a dopaminergic neuron, a neuron that secretes dopamine.
    GO:0002088    lens development in camera-type eye    The process whose specific outcome is the progression of the lens over time, from its formation to the mature structure. The lens is a transparent structure in the eye through which light is focused onto the retina. An example of this process is found in Mus musculus.
    GO:0070306    lens fiber cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a lens fiber cell, any of the elongated, tightly packed cells that make up the bulk of the mature lens in the camera-type eye. The cytoplasm of a lens fiber cell is devoid of most intracellular organelles including the cell nucleus, and contains primarily crystallins, a group of water-soluble proteins expressed in vary large quantities.
    GO:0002089    lens morphogenesis in camera-type eye    The process in which the anatomical structures of the lens are generated and organized. The lens is a transparent structure in the eye through which light is focused onto the retina. An example of this process is found in Mus musculus.
    GO:0007626    locomotory behavior    The specific movement from place to place of an organism in response to external or internal stimuli. Locomotion of a whole organism in a manner dependent upon some combination of that organism's internal state and external conditions.
    GO:0030901    midbrain development    The process whose specific outcome is the progression of the midbrain over time, from its formation to the mature structure. The midbrain is the middle division of the three primary divisions of the developing chordate brain or the corresponding part of the adult brain (in vertebrates, includes a ventral part containing the cerebral peduncles and a dorsal tectum containing the corpora quadrigemina and that surrounds the aqueduct of Sylvius connecting the third and fourth ventricles).
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0048666    neuron development    The process whose specific outcome is the progression of a neuron over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell.
    GO:0045944    positive regulation of transcription by RNA polymerase II    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006366    transcription by RNA polymerase II    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lkx)
 
  Sites
(no "Sites" information available for 2lkx)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lkx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lkx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PITX2_HUMAN | Q99697
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PITX3_HUMAN | O75364
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  137600
    Disease InformationOMIM
  180500
    Disease InformationOMIM
  180550
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PITX2_HUMAN | Q99697
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PITX3_HUMAN | O75364
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PITX2_HUMAN | Q996972l7f 2l7m

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LKX)