1UV9 - JenaLib

Theor.Model - manually (Jmol Viewer)

Theoretical Model (Jmol Viewer)

Title :   HOMOLOGY MODELING OF GPIIB

Authors :   J. Yang, C. Zhan, X. Dong

Date :   19 Jan 04 (Deposition) - 26 Feb 04 (Release) - 12 Aug 04 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A

Keywords :   Gpiib, Homology Modeling, Integrin, Cell Adhesion, Glycoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Yang, C. Zhan, X. Dong, K. Yang, F. Wang
Interaction Of Human Fibrinogen Receptor (Gpiib-Iiia) With Decorsin
Acta Pharmacol. Sin. V. 25 1096 2004
PubMed: search
(for further references see the PDB file header)

Molecule 1 - INTEGRIN ALPHA-IIB
	Chains	:	A
	Fragment	:	RESIDUES 32-973
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Synonym	:	PLATELET MEMBRANE GLYCOPROTEIN IIB, GPIIB, GPALPHA IIB, CD41 ANTIGEN


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1UV9)

(no "Site" information available for 1UV9)

Theoretical Model

No.	Residues
1	A:146	-	A:167
2	A:473	-	A:484
3	A:490	-	A:545
4	A:602	-	A:608
5	A:674	-	A:687

(no "Cis Peptide Bond" information available for 1UV9)

Theoretical Model (35, 35)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_014176	T	40	I	ITA2B_HUMAN	Polymorphism	5915	A	T	9	I
02	UniProt	VAR_030445	L	86	P	ITA2B_HUMAN	Disease (GT)	---	A	L	55	P
03	UniProt	VAR_030446	A	139	V	ITA2B_HUMAN	Disease (GT)	---	A	A	108	V
04	UniProt	VAR_030447	C	161	W	ITA2B_HUMAN	Disease (GT)	---	A	C	130	W
05	UniProt	VAR_030448	Y	174	H	ITA2B_HUMAN	Disease (GT)	---	A	Y	143	H
06	UniProt	VAR_009885	P	176	A	ITA2B_HUMAN	Disease (GT)	---	A	P	145	A
07	UniProt	VAR_009886	P	176	L	ITA2B_HUMAN	Disease (GT)	---	A	P	145	L
08	UniProt	VAR_030449	F	202	C	ITA2B_HUMAN	Disease (GT)	---	A	F	171	C
09	UniProt	VAR_030450	T	207	I	ITA2B_HUMAN	Disease (GT)	---	A	T	176	I
10	UniProt	VAR_030451	L	214	P	ITA2B_HUMAN	Disease (GT)	137852911	A	L	183	P
11	UniProt	VAR_030452	F	222	L	ITA2B_HUMAN	Disease (GT)	---	A	F	191	L
12	UniProt	VAR_030453	G	267	E	ITA2B_HUMAN	Disease (GT)	---	A	G	236	E
13	UniProt	VAR_003979	G	273	D	ITA2B_HUMAN	Disease (GT)	137852907	A	G	242	D
14	UniProt	VAR_054820	G	313	A	ITA2B_HUMAN	Polymorphism	1126554	A	A	282	A
15	UniProt	VAR_009887	F	320	S	ITA2B_HUMAN	Disease (GT)	---	A	F	289	S
16	UniProt	VAR_030454	V	329	F	ITA2B_HUMAN	Disease (GT)	---	A	V	298	F
17	UniProt	VAR_009888	E	355	K	ITA2B_HUMAN	Disease (GT)	137852910	A	E	324	K
18	UniProt	VAR_003980	R	358	H	ITA2B_HUMAN	Disease (GT)	137852908	A	R	327	H
19	UniProt	VAR_030455	G	380	D	ITA2B_HUMAN	Disease (GT)	766006685	A	G	349	D
20	UniProt	VAR_030456	I	405	T	ITA2B_HUMAN	Disease (GT)	75622274	A	I	374	T
21	UniProt	VAR_030457	G	412	R	ITA2B_HUMAN	Disease (GT)	780786843	A	G	381	R
22	UniProt	VAR_003981	G	449	D	ITA2B_HUMAN	Disease (GT)	---	A	G	418	D
23	UniProt	VAR_030459	A	581	D	ITA2B_HUMAN	Disease (GT)	---	A	A	550	D
24	UniProt	VAR_030460	I	596	T	ITA2B_HUMAN	Disease (GT)	76811038	A	I	565	T
25	UniProt	VAR_054821	V	649	L	ITA2B_HUMAN	Polymorphism	7207402	A	V	618	L
26	UniProt	VAR_030461	C	705	R	ITA2B_HUMAN	Disease (GT)	77961246	A	C	674	R
27	UniProt	VAR_030462	L	752	V	ITA2B_HUMAN	Disease (GT)	761174160	A	L	721	V
28	UniProt	VAR_030463	R	755	P	ITA2B_HUMAN	Disease (GT)	763762304	A	R	724	P
29	UniProt	VAR_003982	Q	778	P	ITA2B_HUMAN	Disease (GT)	74475415	A	Q	747	P
30	UniProt	VAR_030464	L	847	P	ITA2B_HUMAN	Disease (GT)	---	A	L	816	P
31	UniProt	VAR_003983	I	874	S	ITA2B_HUMAN	Polymorphism	5911	A	I	843	S
32	UniProt	VAR_069917	V	934	F	ITA2B_HUMAN	Disease (GT)	77458039	A	V	903	F
33	UniProt	VAR_030465	P	943	L	ITA2B_HUMAN	Disease (GT)	---	A	P	912	L
34	UniProt	VAR_069918	S	957	L	ITA2B_HUMAN	Disease (GT)	80002943	A	S	926	L
35	UniProt	VAR_014177	Y	968	N	ITA2B_HUMAN	Polymorphism	5914	A	Y	937	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (1, 7)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FG_GAP	PS51470	FG-GAP repeat profile.	ITA2B_HUMAN	35-96 110-173 187-238 306-371 251-305 373-432 435-496	7	A:4-65 A:79-142 A:156-207 A:275-340 A:220-274 A:342-401 A:404-465

Theoretical Model (28, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000262407	1	ENSE00000854286	chr17:42466873-42466654	220	ITA2B_HUMAN	1-63	63	1	A:1-32	32
1.2	ENST00000262407	2	ENSE00000390828	chr17:42463499-42463378	122	ITA2B_HUMAN	63-104	42	1	A:32-73	42
1.3	ENST00000262407	3	ENSE00000732018	chr17:42463289-42463192	98	ITA2B_HUMAN	104-136	33	1	A:73-105	33
1.4	ENST00000262407	4	ENSE00000732019	chr17:42463084-42462919	166	ITA2B_HUMAN	137-192	56	1	A:106-161	56
1.5	ENST00000262407	5	ENSE00001504857	chr17:42462703-42462654	50	ITA2B_HUMAN	192-208	17	1	A:161-177	17
1.6	ENST00000262407	6	ENSE00001504855	chr17:42462577-42462532	46	ITA2B_HUMAN	209-224	16	1	A:178-193	16
1.7	ENST00000262407	7	ENSE00000854285	chr17:42462444-42462316	129	ITA2B_HUMAN	224-267	44	1	A:193-236	44
1.8	ENST00000262407	8	ENSE00001504854	chr17:42461953-42461906	48	ITA2B_HUMAN	267-283	17	1	A:236-252	17
1.9	ENST00000262407	9	ENSE00000854284	chr17:42461722-42461679	44	ITA2B_HUMAN	283-297	15	1	A:252-266	15
1.10	ENST00000262407	10	ENSE00000732026	chr17:42461506-42461453	54	ITA2B_HUMAN	298-315	18	1	A:267-284	18
1.11	ENST00000262407	11	ENSE00000732027	chr17:42461314-42461262	53	ITA2B_HUMAN	316-333	18	1	A:285-302	18
1.12	ENST00000262407	12	ENSE00000732028	chr17:42461072-42460861	212	ITA2B_HUMAN	333-404	72	1	A:302-373	72
1.13	ENST00000262407	13	ENSE00000732030	chr17:42458429-42458247	183	ITA2B_HUMAN	404-465	62	1	A:373-434	62
1.14	ENST00000262407	14	ENSE00000732031	chr17:42458013-42457968	46	ITA2B_HUMAN	465-480	16	1	A:434-449	16
1.15	ENST00000262407	15	ENSE00000732032	chr17:42457858-42457754	105	ITA2B_HUMAN	480-515	36	1	A:449-484	36
1.16	ENST00000262407	16	ENSE00000732033	chr17:42457669-42457614	56	ITA2B_HUMAN	515-534	20	1	A:484-503	20
1.17	ENST00000262407	17	ENSE00000732034	chr17:42457521-42457370	152	ITA2B_HUMAN	534-584	51	1	A:503-553	51
1.18	ENST00000262407	18	ENSE00000732036	chr17:42457182-42457057	126	ITA2B_HUMAN	585-626	42	1	A:554-595	42
1.19	ENST00000262407	19	ENSE00000732038	chr17:42456078-42456011	68	ITA2B_HUMAN	627-649	23	1	A:596-618	23
1.20	ENST00000262407	20	ENSE00000732040	chr17:42455877-42455730	148	ITA2B_HUMAN	649-698	50	1	A:618-667	50
1.21	ENST00000262407	21	ENSE00000732042	chr17:42455158-42455066	93	ITA2B_HUMAN	699-729	31	1	A:668-698	31
1.22	ENST00000262407	22	ENSE00000732043	chr17:42454456-42454377	80	ITA2B_HUMAN	730-756	27	1	A:699-725	27
1.23	ENST00000262407	23	ENSE00000732044	chr17:42453756-42453676	81	ITA2B_HUMAN	756-783	28	1	A:725-752	28
1.24	ENST00000262407	24	ENSE00000732045	chr17:42453552-42453453	100	ITA2B_HUMAN	783-816	34	1	A:752-785	34
1.25	ENST00000262407	25	ENSE00000732046	chr17:42453353-42453201	153	ITA2B_HUMAN	817-867	51	1	A:786-836	51
1.26a	ENST00000262407	26a	ENSE00000732047	chr17:42453084-42452959	126	ITA2B_HUMAN	868-909	42	1	A:837-878	42
1.27	ENST00000262407	27	ENSE00000732049	chr17:42452479-42452366	114	ITA2B_HUMAN	910-947	38	1	A:879-916	38
1.28	ENST00000262407	28	ENSE00001321776	chr17:42452128-42452027	102	ITA2B_HUMAN	948-981	34	1	A:917-942	26
1.29	ENST00000262407	29	ENSE00000854277	chr17:42451838-42451722	117	ITA2B_HUMAN	982-1020	39	0	-	-
1.30	ENST00000262407	30	ENSE00000854276	chr17:42449791-42449550	242	ITA2B_HUMAN	1021-1039	19	0	-	-

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:942
 aligned with ITA2B_HUMAN | P08514 from UniProtKB/Swiss-Prot  Length:1039

    Alignment length:942
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921       931       941       951       961       971  
          ITA2B_HUMAN    32 LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPL 973
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........eeee..........eeee.......eeeeee............eeeeee....................eee..ee............eee....eeeee...eee..........ee..eee.........................................ee.......eeee........eeee.hhhhhhhhh..............ee..............eeee...........eeeee........eeeee.....eeeeee...........eee..........eeeee................eeeee............eeeee......hhhheeee...........eeeee...hhhhh.eeeee.ee..ee.....eeee............eee...........eeeee....eeeee....eeeee..eee.....................eeeeee..eee.......eeeeeeeee..........eee......eeeeeeee........eeeeeee............eeeeeeee..........ee..........ee...............eeee.......ee....eeeeeeeeeee........eeeee......eeee..........eeeeee....eeeeee........eeeeeeeeeee........eeeeeeeee...........eeeeeeee....eeeeeee.................hhhhhh.eeeeeeeeee.....eeeeeeeeee.ee....ee.eeeeeeee..eeeee.........................................................eeeeeeeeee...eeeeeeeeee..................eeeeeeee........ Sec.struct. author
             SAPs(SNPs) (1) --------I---------------------------------------------P----------------------------------------------------V---------------------W------------H-A-------------------------C----I------P-------L--------------------------------------------E-----D---------------------------------------A------S--------F-------------------------K--H---------------------D------------------------T------R------------------------------------D-----------------------------------------------------------------------------------------------------------------------------------D--------------T----------------------------------------------------L-------------------------------------------------------R----------------------------------------------V--P----------------------P--------------------------------------------------------------------P--------------------------S-----------------------------------------------------------F--------L-------------L----------N----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------L----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---FG_GAP  PDB: A:4-65 UniProt: 35-96                            -------------FG_GAP  PDB: A:79-142 UniProt: 110-173                          -------------FG_GAP  PDB: A:156-207 UniProt: 187-238             ------------FG_GAP  PDB: A:220-274 UniProt: 251-305                FG_GAP  PDB: A:275-340 UniProt: 306-371                           -FG_GAP  PDB: A:342-401 UniProt: 373-432                     --FG_GAP  PDB: A:404-465 UniProt: 435-496                       --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:1-32           ----------------------------------------Exon 1.3  PDB: A:73-105          Exon 1.4  PDB: A:106-161 UniProt: 137-192               ----------------Exon 1.6        ------------------------------------------Exon 1.8         --------------Exon 1.10         Exon 1.11         ----------------------------------------------------------------------Exon 1.13  PDB: A:373-434 UniProt: 404-465                    --------------Exon 1.15  PDB: A:449-484           ------------------Exon 1.17  PDB: A:503-553 UniProt: 534-584         Exon 1.18  PDB: A:554-595 UniProt: 585-626Exon 1.19              -------------------------------------------------Exon 1.21  PDB: A:668-698      Exon 1.22  PDB: A:699-725  --------------------------Exon 1.24  PDB: A:752-785         Exon 1.25  PDB: A:786-836 UniProt: 817-867         Exon 1.26a  PDB: A:837-878                Exon 1.27  PDB: A:879-916             Exon 1.28  PDB: A:917-942  Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.2  PDB: A:32-73 UniProt: 63-104    ---------------------------------------------------------------------------------------Exon 1.5         ---------------Exon 1.7  PDB: A:193-236 UniProt: 224-267   ---------------Exon 1.9       -----------------------------------Exon 1.12  PDB: A:302-373 UniProt: 333-404                              ------------------------------------------------------------Exon 1.14       ----------------------------------Exon 1.16           ------------------------------------------------------------------------------------------------------------------Exon 1.20  PDB: A:618-667 UniProt: 649-698        ---------------------------------------------------------Exon 1.23  PDB: A:725-752   ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1uv9 A   1 LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRAEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPL 942
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1UV9)

(no "CATH Domain" information available for 1UV9)

(no "Pfam Domain" information available for 1UV9)

Theoretical Model(hide GO term definitions)

Chain A (ITA2B_HUMAN | P08514)

molecular function
	GO:0050840	extracellular matrix binding	Interacting selectively and non-covalently with a component of the extracellular matrix.
	GO:0070051	fibrinogen binding	Interacting selectively and non-covalently with fibrinogen, a highly soluble hexameric glycoprotein complex that is found in blood plasma and is converted to fibrin by thrombin in the coagulation cascade.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0007229	integrin-mediated signaling pathway	A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0002687	positive regulation of leukocyte migration	Any process that activates or increases the frequency, rate, or extent of leukocyte migration.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0008305	integrin complex	A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031092	platelet alpha granule membrane	The lipid bilayer surrounding the platelet alpha granule.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1uv9)

	Sites
(no "Sites" information available for 1uv9)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1uv9)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1uv9
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ITA2B_HUMAN \| P08514
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	273800
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ITA2B_HUMAN \| P08514
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1dpk	SOLUTION STRUCTURE OF THE CYTOPLASMIC DOMAIN OF THE INTEGRIN ALPHA-IIB SUBUNIT
1dpq	SOLUTION STRUCTURE OF THE CONSTITUTIVELY ACTIVE MUTANT OF THE INTEGRIN ALPHA IIB CYTOPLASMIC DOMAIN.
1jx5	THEORETICAL MODEL OF THE BETA-PROPELLER DOMAIN OF INTEGRINALPHAIIB
1kup	SOLUTION STRUCTURE OF THE MEMBRANE PROXIMAL REGIONS OFALPHA-IIB AND BETA-3 INTEGRINS
1kuz	SOLUTION STRUCTURE OF THE MEMBRANE PROXIMAL REGIONS OFALPHA-IIB AND BETA-3 INTEGRINS
1m8o	PLATELET INTEGRIN ALFAIIB-BETA3 CYTOPLASMIC DOMAIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (5, 5)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (35, 35)

PROSITE Motifs (1, 7)

Exons (28, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (23, 23)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File