Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE 20S PROTEASOME FROM YEAST AT 2.4 ANGSTROMS RESOLUTION
 
Authors :  M. Groll, L. Ditzel, J. Loewe, D. Stock, M. Bochtler, H. D. Bartunik, R. Huber
Date :  26 Feb 97  (Deposition) - 15 Apr 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,1,2
Keywords :  Multicatalytic Proteinase, 20S Proteasome, Protein Degradation, Antigen Processing, Hydrolase, Protease (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Groll, L. Ditzel, J. Lowe, D. Stock, M. Bochtler, H. D. Bartunik, R. Huber
Structure Of 20S Proteasome From Yeast At 2. 4 A Resolution.
Nature V. 386 463 1997
PubMed-ID: 9087403  |  Reference-DOI: 10.1038/386463A0
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 20S PROTEASOME
    Chains: A, O
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 2 - 20S PROTEASOME
    Chains: B, P
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 3 - 20S PROTEASOME
    Chains: C, Q
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 4 - 20S PROTEASOME
    Chains: D, R
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 5 - 20S PROTEASOME
    Chains: E, S
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 6 - 20S PROTEASOME
    Chains: F, T
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 7 - 20S PROTEASOME
    Chains: G, U
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 8 - 20S PROTEASOME
    Chains: H, V
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 9 - 20S PROTEASOME
    Chains: I, W
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 10 - 20S PROTEASOME
    Chains: J, X
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 11 - 20S PROTEASOME
    Chains: K, Y
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 12 - 20S PROTEASOME
    Chains: L, Z
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 13 - 20S PROTEASOME
    Chains: M, 1
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 14 - 20S PROTEASOME
    Chains: N, 2
    EC Number: 3.4.99.46
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728
Asymmetric/Biological Unit : ABCDEFGHIJKLMNOPQRSTUVWXYZ12

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 20)

Asymmetric/Biological Unit (1, 20)
No.NameCountTypeFull Name
1MG20Ligand/IonMAGNESIUM ION

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETHR A:17 , TYR A:128 , ARG A:131 , MET A:134 , HOH A:260BINDING SITE FOR RESIDUE MG A 1
02AC2SOFTWAREGLU E:105 , SER M:76 , SER M:79 , HOH M:220 , HOH M:226 , HOH M:227BINDING SITE FOR RESIDUE MG E 2
03AC3SOFTWAREGLY J:131 , SER J:134 , HOH J:225 , HOH J:266BINDING SITE FOR RESIDUE MG J 197
04AC4SOFTWARETHR M:183 , HIS M:186 , VAL M:189 , HOH M:242 , HOH M:303BINDING SITE FOR RESIDUE MG M 214
05AC5SOFTWAREALA J:166 , ASP J:169 , SER J:172 , HOH J:204 , HOH J:206BINDING SITE FOR RESIDUE MG J 198
06AC6SOFTWARELEU 2:26 , ILE H:163 , ASP H:166 , SER H:169BINDING SITE FOR RESIDUE MG H 197
07AC7SOFTWAREASP 1:213 , HOH 1:324 , ILE I:163 , ASP I:166 , SER I:169BINDING SITE FOR RESIDUE MG I 223
08AC8SOFTWAREALA L:165 , ASP L:168 , SER L:171 , HOH L:280 , ASP X:196BINDING SITE FOR RESIDUE MG L 213
09AC9SOFTWAREALA A:132 , TYR A:133 , HOH A:313 , TYR B:5 , ASN G:126 , HOH G:249BINDING SITE FOR RESIDUE MG A 253
10BC1SOFTWARETHR O:17 , TYR O:128 , ARG O:131 , MET O:134 , HOH O:1020BINDING SITE FOR RESIDUE MG O 1
11BC2SOFTWARESER 1:76 , SER 1:79 , HOH 1:296 , HOH 1:301 , HOH 1:302 , GLU S:105BINDING SITE FOR RESIDUE MG S 2
12BC3SOFTWAREGLY X:131 , SER X:134 , HOH X:252 , HOH X:293BINDING SITE FOR RESIDUE MG X 197
13BC4SOFTWARETHR 1:183 , HIS 1:186 , VAL 1:189 , HOH 1:244 , HOH 1:317BINDING SITE FOR RESIDUE MG 1 214
14BC5SOFTWAREALA X:166 , ASP X:169 , SER X:172 , HOH X:232 , HOH X:234BINDING SITE FOR RESIDUE MG X 198
15BC6SOFTWAREILE V:163 , ASP V:166 , SER V:169BINDING SITE FOR RESIDUE MG V 197
16BC7SOFTWAREASP M:213 , ILE W:163 , ASP W:166 , SER W:169 , HOH W:257BINDING SITE FOR RESIDUE MG W 223
17BC8SOFTWAREASP J:196 , HOH J:245 , ALA Z:165 , ASP Z:168 , SER Z:171BINDING SITE FOR RESIDUE MG Z 213
18BC9SOFTWAREALA O:132 , TYR O:133 , HOH O:1075 , TYR P:5 , SER U:12 , ASN U:126 , HOH U:1014BINDING SITE FOR RESIDUE MG O 253

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1RYP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1RYP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1RYP)

(-) PROSITE Motifs  (4, 50)

Asymmetric/Biological Unit (4, 50)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEASOME_BETA_2PS51476 Proteasome beta-type subunit profile.PSB4_YEAST1-184
 		  2K:-1-183
Y:-1-183
PSB3_YEAST9-190
 		  2J:-1-181
X:-1-181
PSB1_YEAST19-197
 		  2H:-1-178
V:-1-178
PSB6_YEAST28-226
 		  21:-1-198
M:-1-198
PSB7_YEAST41-233
 		  22:-1-192
N:-1-192
2PROTEASOME_ALPHA_1PS00388 Proteasome alpha-type subunits signature.PSA4_YEAST4-26
 		  2D:4-26
R:4-26
PSA2_YEAST5-27
 		  2B:5-27
P:5-27
PSA6_YEAST6-28
 		  2F:6-28
T:6-28
PSA3_YEAST6-28
 		  2C:6-28
Q:6-28
PSA7_YEAST8-30
 		  2G:7-29
U:7-29
PSA1_YEAST12-34
 		  2A:12-34
O:12-34
3PROTEASOME_BETA_1PS00854 Proteasome beta-type subunits signature.PSB4_YEAST5-52
 		  2K:4-51
Y:4-51
PSB3_YEAST13-59
 		  2J:4-50
X:4-50
PSB1_YEAST23-70
 		  2H:4-51
V:4-51
PSB6_YEAST32-79
 		  21:4-51
M:4-51
PSB2_YEAST33-80
 		  2I:4-51
W:4-51
PSB7_YEAST45-92
 		  22:4-51
N:4-51
PSB5_YEAST79-126
 		  2L:4-51
Z:4-51
4PROTEASOME_ALPHA_2PS51475 Proteasome alpha-type subunit profile.PSA4_YEAST19-233
 		  2D:19-233
R:19-233
PSA2_YEAST20-247
 		  2B:20-247
P:20-247
PSA6_YEAST21-234
 		  2F:21-234
T:21-234
PSA3_YEAST21-239
 		  2C:21-239
Q:21-239
PSA5_YEAST23-240
 		  2E:23-240
S:23-240
PSA7_YEAST23-240
 		  2G:22-239
U:22-239
PSA1_YEAST27-245
 		  2A:27-245
O:27-245

(-) Exons   (15, 30)

Asymmetric/Biological Unit (15, 30)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YBL041W1YBL041W.1II:141250-141975726PSB6_YEAST1-24124121:-9-213
M:-9-213		222
222
2.1YER012W1YER012W.1V:177834-178430597PSB4_YEAST1-1981982K:-1-197
Y:-1-197		198
198
3.1YER094C1YER094C.1V:349342-348725618PSB3_YEAST1-2052052J:-8-196
X:-8-196		204
204
4.1YFR050C1YFR050C.1VI:249853-249053801PSB7_YEAST1-26626622:-8-225
N:-8-225		233
233
5.1YGL011C1YGL011C.1VII:475252-474494759PSA1_YEAST1-2522522A:10-252
O:10-252		243
243
6.1YGR135W1YGR135W.1VII:761397-762173777PSA3_YEAST1-2582582C:2-245
Q:2-245		244
244
7.1YGR253C1YGR253C.1VII:999145-998363783PSA5_YEAST1-2602602E:9-250
S:9-250		242
242
8.1YJL001W1YJL001W.1X:435156-43522065PSB1_YEAST1-22222H:-9-3
V:-9-3		12
12
8.2YJL001W2YJL001W.2X:435337-435919583PSB1_YEAST22-2151942H:3-196
V:3-196		194
194
9.1YML092C1YML092C.1XIII:86739-85987753PSA2_YEAST1-2502502B:1-250
P:1-250		250
250
10.1YMR314W1YMR314W.1XIII:901708-902412705PSA6_YEAST1-2342342F:2-234
T:2-234		233
233
11.1YOL038W1YOL038W.1XV:255336-256100765PSA4_YEAST1-2542542D:3-243
R:3-243		241
241
12.1YOR157C1YOR157C.1XV:631752-630967786PSB2_YEAST1-2612612I:1-222
W:1-222		222
222
13.1YOR362C1YOR362C.1XV:1018744-1017878867PSA7_YEAST1-2882882G:4-247
U:4-247		244
244
14.1YPR103W1YPR103W.1XVI:732347-733210864PSB5_YEAST1-2872872L:1-212
Z:1-212		212
212

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain 1 from PDB  Type:PROTEIN  Length:222
 aligned with PSB6_YEAST | P23724 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:222
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239  
           PSB6_YEAST    20 QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD 241
               SCOP domains d1ryp1_ 1: Proteasome beta subunit (catalytic)                                                                                                                                                                                 SCOP domains
               CATH domains 1ryp100 1:-9-213 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........eeeeee....eeeeee..eee..eeee.............eeeeee.hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh......eeeeeeee.....eeeeee.....eeee.eeeee..hhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhh......eeeeeeee..eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) --------PROTEASOME_BETA_2  PDB: 1:-1-198 UniProt: 28-226                                                                                                                                                       --------------- PROSITE (3)
                PROSITE (4) ------------PROTEASOME_BETA_1  PDB: 1:4-51 UniProt: 32-79   ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
               Transcript 1 Exon 1.1  PDB: 1:-9-213 UniProt: 1-241 [INCOMPLETE]                                                                                                                                                                            Transcript 1
                 1ryp 1  -9 QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD 213
                                    |1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211  
                                   -1|                                                                                                                                                                                                                    
                                     1                                                                                                                                                                                                                    


Chain 2 from PDB  Type:PROTEIN  Length:233
 aligned with PSB7_YEAST | P30657 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:233
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263   
           PSB7_YEAST    34 TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI 266
               SCOP domains d1ryp2_ 2: Proteasome beta subunit (catalytic)                                                                                                                                                                                            SCOP domains
               CATH domains 1ryp200 2:-8-225 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeee..eeeeeee................eee....eeeeeee.hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhh.....eeeeeeee.....eeeeeee.........eee.hhhhhhhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeeee...eeeee..........hhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------PROTEASOME_BETA_2  PDB: 2:-1-192 UniProt: 41-233                                                                                                                                                 --------------------------------- PROSITE (6)
                PROSITE (7) -----------PROTEASOME_BETA_1  PDB: 2:4-51 UniProt: 45-92   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (7)
               Transcript 4 Exon 4.1  PDB: 2:-8-225 UniProt: 1-266 [INCOMPLETE]                                                                                                                                                                                       Transcript 4
                 1ryp 2  -8 TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI 225
                                   ||2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222   
                                  -1|                                                                                                                                                                                                                                
                                    1                                                                                                                                                                                                                                


Chain A from PDB  Type:PROTEIN  Length:243
 aligned with PSA1_YEAST | P21243 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:243
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   
           PSA1_YEAST    10 AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 252
               SCOP domains d1rypa_ A: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                 SCOP domains
               CATH domains 1rypA00 A:10-252 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh...........hhhhhhhhhhh.....eeeee...eeeeeee.........hhh...eee.....eeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh........eeeeeee..eeee..hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------PROTEASOME_ALPHA_2  PDB: A:27-245 UniProt: 27-245                                                                                                                                                                          ------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) --PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               Transcript 5 Exon 5.1  PDB: A:10-252 UniProt: 1-252 [INCOMPLETE]                                                                                                                                                                                                 Transcript 5
                 1ryp A  10 AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 252
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   


Chain B from PDB  Type:PROTEIN  Length:250
 aligned with PSA2_YEAST | P23639 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250
           PSA2_YEAST     1 MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 250
               SCOP domains d1rypb_ B: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                        SCOP domains
               CATH domains 1rypB00 B:1-250 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhh...eeeee....eeeeee.........hhh....eeee..eeeeeee.hhhhhhhhhhhhhhhhh..hhhh.....hhhhhhhhhhhhhhhh.........eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.........eeeeee....hhh.............eee....hhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----PROTEASOME_ALPHA_1     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) -------------------PROTEASOME_ALPHA_2  PDB: B:20-247 UniProt: 20-247                                                                                                                                                                                   --- PROSITE (13)
               Transcript 9 Exon 9.1  PDB: B:1-250 UniProt: 1-250                                                                                                                                                                                                                      Transcript 9
                 1ryp B   1 MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250


Chain C from PDB  Type:PROTEIN  Length:244
 aligned with PSA3_YEAST | P23638 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:244
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241    
           PSA3_YEAST     2 GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT 245
               SCOP domains d1rypc_ C: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                  SCOP domains
               CATH domains 1rypC00 C:2-245 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.............hhhhhhhhhhhh...eeeeee..eeeeeee................eee....eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.......hhheeeeeee........eeee..hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----PROTEASOME_ALPHA_1     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) -------------------PROTEASOME_ALPHA_2  PDB: C:21-239 UniProt: 21-239                                                                                                                                                                          ------ PROSITE (14)
               Transcript 6 Exon 6.1  PDB: C:2-245 UniProt: 1-258 [INCOMPLETE]                                                                                                                                                                                                   Transcript 6
                 1ryp C   2 GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT 245
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241    


Chain D from PDB  Type:PROTEIN  Length:241
 aligned with PSA4_YEAST | P40303 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:241
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242 
           PSA4_YEAST     3 GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQ 243
               SCOP domains d1rypd_ D: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                               SCOP domains
               CATH domains 1rypD00 D:3-243 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhh...eeeee....eeeeee................eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.........eeeeeee........eeeee.....eee..eeee...hhhhhhhhhh..........hhhhhhhhhhhhhhhh......eeeeeee...eeee..hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -PROTEASOME_ALPHA_1     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------PROTEASOME_ALPHA_2  PDB: D:19-233 UniProt: 19-233                                                                                                                                                                      ---------- PROSITE (11)
              Transcript 11 Exon 11.1  PDB: D:3-243 UniProt: 1-254 [INCOMPLETE]                                                                                                                                                                                               Transcript 11
                 1ryp D   3 GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQ 243
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242 


Chain E from PDB  Type:PROTEIN  Length:242
 aligned with PSA5_YEAST | P32379 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:242
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248  
           PSA5_YEAST     9 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
               SCOP domains d1rype_ E: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                SCOP domains
               CATH domains 1rypE00 E:9-250 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhh...eeeee....eeeeee.........hhh...eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh......................eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.........eeeeeee...eeee..hhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
               PROSITE (17) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (17)
               PROSITE (18) --------------PROTEASOME_ALPHA_2  PDB: E:23-240 UniProt: 23-240                                                                                                                                                                         ---------- PROSITE (18)
               Transcript 7 Exon 7.1  PDB: E:9-250 UniProt: 1-260 [INCOMPLETE]                                                                                                                                                                                                 Transcript 7
                 1ryp E   9 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248  


Chain F from PDB  Type:PROTEIN  Length:233
 aligned with PSA6_YEAST | P40302 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:233
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231   
           PSA6_YEAST     2 FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234
               SCOP domains d1rypf_ F: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                       SCOP domains
               CATH domains 1rypF00 F:2-234 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh.............hhhhhhhhhhhh...eeeee...eeeeeee.............eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........eeeeeeeee..eeeeeee.....eeee.eeee...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh...........eeeeeee.....eeeehhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ----PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) -------------------PROTEASOME_ALPHA_2  PDB: F:21-234 UniProt: 21-234                                                                                                                                                                      PROSITE (15)
              Transcript 10 Exon 10.1  PDB: F:2-234 UniProt: 1-234 [INCOMPLETE]                                                                                                                                                                                       Transcript 10
                 1ryp F   2 FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231   


Chain G from PDB  Type:PROTEIN  Length:244
 aligned with PSA7_YEAST | P21242 from UniProtKB/Swiss-Prot  Length:288

    Alignment length:244
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244    
           PSA7_YEAST     5 GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEIN 248
               SCOP domains d1rypg_ G: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                  SCOP domains
               CATH domains 1rypG00 G:4-247 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhh....eeeeee..eeeeeeeee..............eee...eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.........eeeeeeeee..eeeeeee.....eee..eeee...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh....eeeeeeeee.......eee...hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
               PROSITE (17) ------------------PROTEASOME_ALPHA_2  PDB: G:22-239 UniProt: 23-240                                                                                                                                                                         -------- PROSITE (17)
              Transcript 13 Exon 13.1  PDB: G:4-247 UniProt: 1-288 [INCOMPLETE]                                                                                                                                                                                                  Transcript 13
                 1ryp G   4 GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEIN 247
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243    


Chain H from PDB  Type:PROTEIN  Length:205
 aligned with PSB1_YEAST | P38624 from UniProtKB/Swiss-Prot  Length:215

    Alignment length:205
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     
           PSB1_YEAST    11 LKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 215
               SCOP domains d1ryph_ H: Proteasome beta subunit (catalytic)                                                                                                                                                                SCOP domains
               CATH domains 1rypH00 H:-9-196 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeeee..eeeeee...eee..eeee.....eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh......eeeeeeeee...eeeeeee.....eeee.eeee.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eeeeeee.hhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) --------PROTEASOME_BETA_2  PDB: H:-1-178 UniProt: 19-197                                                                                                                                   ------------------ PROSITE (12)
               PROSITE (13) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) ------------PROTEASOME_BETA_1  PDB: H:4-51 UniProt: 23-70   ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
           Transcript 8 (1) Exon 8.1    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 8 (1)
           Transcript 8 (2) -----------Exon 8.2  PDB: H:3-196 UniProt: 22-215                                                                                                                                                             Transcript 8 (2)
                 1ryp H  -9 LKKGEVSLGASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 196
                                    |1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191     
                                   -1|                                                                                                                                                                                                   
                                     1                                                                                                                                                                                                   


Chain I from PDB  Type:PROTEIN  Length:222
 aligned with PSB2_YEAST | P25043 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:222
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249  
           PSB2_YEAST    30 TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD 251
               SCOP domains d1rypi_ I: Proteasome beta subunit (catalytic)                                                                                                                                                                                 SCOP domains
               CATH domains 1rypI00 I:1-222 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..eeeeee...eee..eeee.....eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh......eeeeeeeee..eeeeeee.....eee..eeee.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh........eeeeee.....eee................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) ---PROTEASOME_BETA_1  PDB: I:4-51 UniProt: 33-80   --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
              Transcript 12 Exon 12.1  PDB: I:1-222 UniProt: 1-261 [INCOMPLETE]                                                                                                                                                                            Transcript 12
                 1ryp I   1 TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD 222
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220  


Chain J from PDB  Type:PROTEIN  Length:204
 aligned with PSB3_YEAST | P25451 from UniProtKB/Swiss-Prot  Length:205

    Alignment length:204
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201    
           PSB3_YEAST     2 SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD 205
               SCOP domains d1rypj_ J: Proteasome beta subunit (catalytic)                                                                                                                                                               SCOP domains
               CATH domains 1rypJ00 J:-8-196 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh....eeeeee...eeeeeee..eee..eeee.....eeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh......eeeeeeee......eeeee............eeeee..hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee...eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (7)
                PROSITE (8) -------PROTEASOME_BETA_2  PDB: J:-1-181 UniProt: 9-190                                                                                                                                       --------------- PROSITE (8)
                PROSITE (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (9)
               PROSITE (10) -----------PROTEASOME_BETA_1  PDB: J:4-50 UniProt: 13-59  -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               Transcript 3 Exon 3.1  PDB: J:-8-196 UniProt: 1-205 [INCOMPLETE]                                                                                                                                                          Transcript 3
                 1ryp J  -8 SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD 196
                                   ||2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192    
                                  -1|                                                                                                                                                                                                   
                                    1                                                                                                                                                                                                   


Chain K from PDB  Type:PROTEIN  Length:198
 aligned with PSB4_YEAST | P22141 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:198
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190        
           PSB4_YEAST     1 MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ 198
               SCOP domains d1rypk_ K: Proteasome beta subunit (catalytic)                                                                                                                                                         SCOP domains
               CATH domains 1rypK00 K:-1-197 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee....eeeeee..eee..eeee.....eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh......eeeeeeeee....eeeeeee.....eee..eee...hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) PROTEASOME_BETA_2  PDB: K:-1-183 UniProt: 1-184                                                                                                                                         -------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ----PROTEASOME_BETA_1  PDB: K:4-51 UniProt: 5-52    -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
               Transcript 2 Exon 2.1  PDB: K:-1-197 UniProt: 1-198                                                                                                                                                                 Transcript 2
                 1ryp K  -1 MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ 197
                            ||       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189        
                           -1|                                                                                                                                                                                                    
                             1                                                                                                                                                                                                    


Chain L from PDB  Type:PROTEIN  Length:212
 aligned with PSB5_YEAST | P30656 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:212
                                    85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285  
           PSB5_YEAST    76 TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG 287
               SCOP domains d1rypl_ L: Proteasome beta subunit (catalytic)                                                                                                                                                                       SCOP domains
               CATH domains 1rypL00 L:1-212 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..eeeeee...eee..eeee.....eeeee..eeee....hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.......eeeeeeee...eeeeeeee....eee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh......eeeeeeee..eeee..eeehhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---PROTEASOME_BETA_1  PDB: L:4-51 UniProt: 79-126  ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
              Transcript 14 Exon 14.1  PDB: L:1-212 UniProt: 1-287 [INCOMPLETE]                                                                                                                                                                  Transcript 14
                 1ryp L   1 TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKRVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG 212
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210  


Chain M from PDB  Type:PROTEIN  Length:222
 aligned with PSB6_YEAST | P23724 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:222
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239  
           PSB6_YEAST    20 QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD 241
               SCOP domains d1rypm_ M: Proteasome beta subunit (catalytic)                                                                                                                                                                                 SCOP domains
               CATH domains 1rypM00 M:-9-213 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........eeeeee....eeeeee..eee..eeee.....eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh......eeeeeeee.....eeeeee.....eeee.eeeeehhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhh......eeeeeeee..eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) --------PROTEASOME_BETA_2  PDB: M:-1-198 UniProt: 28-226                                                                                                                                                       --------------- PROSITE (3)
                PROSITE (4) ------------PROTEASOME_BETA_1  PDB: M:4-51 UniProt: 32-79   ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
               Transcript 1 Exon 1.1  PDB: M:-9-213 UniProt: 1-241 [INCOMPLETE]                                                                                                                                                                            Transcript 1
                 1ryp M  -9 QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD 213
                                    |1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211  
                                   -1|                                                                                                                                                                                                                    
                                     1                                                                                                                                                                                                                    


Chain N from PDB  Type:PROTEIN  Length:233
 aligned with PSB7_YEAST | P30657 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:233
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263   
           PSB7_YEAST    34 TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI 266
               SCOP domains d1rypn_ N: Proteasome beta subunit (catalytic)                                                                                                                                                                                            SCOP domains
               CATH domains 1rypN00 N:-8-225 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeee..eeeeeee................eee....eeeeeee.hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh......eeeeeeee.....eeeeeee.........eee.hhhhhhhhhhhhh....hhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeeee...eeeee..........hhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------PROTEASOME_BETA_2  PDB: N:-1-192 UniProt: 41-233                                                                                                                                                 --------------------------------- PROSITE (6)
                PROSITE (7) -----------PROTEASOME_BETA_1  PDB: N:4-51 UniProt: 45-92   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (7)
               Transcript 4 Exon 4.1  PDB: N:-8-225 UniProt: 1-266 [INCOMPLETE]                                                                                                                                                                                       Transcript 4
                 1ryp N  -8 TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI 225
                                   ||2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222   
                                  -1|                                                                                                                                                                                                                                
                                    1                                                                                                                                                                                                                                


Chain O from PDB  Type:PROTEIN  Length:243
 aligned with PSA1_YEAST | P21243 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:243
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   
           PSA1_YEAST    10 AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 252
               SCOP domains d1rypo_ O: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                 SCOP domains
               CATH domains 1rypO00 O:10-252 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhh.....eeeee...eeeeeee.........hhh...eee.....eeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.....hhheeeeeee..eeee..hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------PROTEASOME_ALPHA_2  PDB: O:27-245 UniProt: 27-245                                                                                                                                                                          ------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) --PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               Transcript 5 Exon 5.1  PDB: O:10-252 UniProt: 1-252 [INCOMPLETE]                                                                                                                                                                                                 Transcript 5
                 1ryp O  10 AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 252
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   


Chain P from PDB  Type:PROTEIN  Length:250
 aligned with PSA2_YEAST | P23639 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250
           PSA2_YEAST     1 MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 250
               SCOP domains d1rypp_ P: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                        SCOP domains
               CATH domains 1rypP00 P:1-250 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                                 CATH domains
           Pfam domains (1) ----Proteasome_A_N-1rypP03 Proteasome-1rypP01 P:28-214                                                                                                                                                                ------------------------------------ Pfam domains (1)
           Pfam domains (2) ----Proteasome_A_N-1rypP04 Proteasome-1rypP02 P:28-214                                                                                                                                                                ------------------------------------ Pfam domains (2)
         Sec.struct. author ..................hhhhhhhhhhhh...eeeee....eeeeee.........hhh....eeee..eeeeeee.hhhhhhhhhhhhhhhhh..hhhh.....hhhhhhhhhhhhhhhh.........eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.........eeeeee....hhh.............eee..hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----PROTEASOME_ALPHA_1     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) -------------------PROTEASOME_ALPHA_2  PDB: P:20-247 UniProt: 20-247                                                                                                                                                                                   --- PROSITE (13)
               Transcript 9 Exon 9.1  PDB: P:1-250 UniProt: 1-250                                                                                                                                                                                                                      Transcript 9
                 1ryp P   1 MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250


Chain Q from PDB  Type:PROTEIN  Length:244
 aligned with PSA3_YEAST | P23638 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:244
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241    
           PSA3_YEAST     2 GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT 245
               SCOP domains d1rypq_ Q: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                  SCOP domains
               CATH domains 1rypQ00 Q:2-245 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.............hhhhhhhhhhhh...eeeee...eeeeeee................eee....eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.......hhheeeeeee........eeee..hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----PROTEASOME_ALPHA_1     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) -------------------PROTEASOME_ALPHA_2  PDB: Q:21-239 UniProt: 21-239                                                                                                                                                                          ------ PROSITE (14)
               Transcript 6 Exon 6.1  PDB: Q:2-245 UniProt: 1-258 [INCOMPLETE]                                                                                                                                                                                                   Transcript 6
                 1ryp Q   2 GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT 245
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241    


Chain R from PDB  Type:PROTEIN  Length:241
 aligned with PSA4_YEAST | P40303 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:241
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242 
           PSA4_YEAST     3 GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQ 243
               SCOP domains d1rypr_ R: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                               SCOP domains
               CATH domains 1rypR00 R:3-243 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhh....eeeee....eeeeee................eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.........eeeeeeee......eeeeee.....eee..eeee...hhhhhhhhhh..........hhhhhhhhhhhhhhhh......eeeeeee...eee...hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -PROTEASOME_ALPHA_1     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------PROTEASOME_ALPHA_2  PDB: R:19-233 UniProt: 19-233                                                                                                                                                                      ---------- PROSITE (11)
              Transcript 11 Exon 11.1  PDB: R:3-243 UniProt: 1-254 [INCOMPLETE]                                                                                                                                                                                               Transcript 11
                 1ryp R   3 GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQ 243
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242 


Chain S from PDB  Type:PROTEIN  Length:242
 aligned with PSA5_YEAST | P32379 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:242
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248  
           PSA5_YEAST     9 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
               SCOP domains d1ryps_ S: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                SCOP domains
               CATH domains 1rypS00 S:9-250 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                         CATH domains
           Pfam domains (1) Proteasome_A_N-1rypS03Proteasome-1rypS01 S:31-222                                                                                                                                                                     ---------------------------- Pfam domains (1)
           Pfam domains (2) Proteasome_A_N-1rypS04Proteasome-1rypS02 S:31-222                                                                                                                                                                     ---------------------------- Pfam domains (2)
         Sec.struct. author .............hhhhhhhhhhhh...eeeee....eeeeee.........hhh...eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh...................eeeeeeeee...eeeeeee.....eee..eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhh.........eeeeeee...eeee..hhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
               PROSITE (17) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (17)
               PROSITE (18) --------------PROTEASOME_ALPHA_2  PDB: S:23-240 UniProt: 23-240                                                                                                                                                                         ---------- PROSITE (18)
               Transcript 7 Exon 7.1  PDB: S:9-250 UniProt: 1-260 [INCOMPLETE]                                                                                                                                                                                                 Transcript 7
                 1ryp S   9 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248  


Chain T from PDB  Type:PROTEIN  Length:233
 aligned with PSA6_YEAST | P40302 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:233
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231   
           PSA6_YEAST     2 FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234
               SCOP domains d1rypt_ T: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                       SCOP domains
               CATH domains 1rypT00 T:2-234 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh.............hhhhhhhhhhh....eeeee...eeeeeee.............eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.........eeeeeeeee..eeeeeee.....eeee.eeee...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh...........eeeeeee.....eeeehhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ----PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) -------------------PROTEASOME_ALPHA_2  PDB: T:21-234 UniProt: 21-234                                                                                                                                                                      PROSITE (15)
              Transcript 10 Exon 10.1  PDB: T:2-234 UniProt: 1-234 [INCOMPLETE]                                                                                                                                                                                       Transcript 10
                 1ryp T   2 FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231   


Chain U from PDB  Type:PROTEIN  Length:244
 aligned with PSA7_YEAST | P21242 from UniProtKB/Swiss-Prot  Length:288

    Alignment length:244
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244    
           PSA7_YEAST     5 GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEIN 248
               SCOP domains d1rypu_ U: Proteasome alpha subunit (non-catalytic)                                                                                                                                                                                                  SCOP domains
               CATH domains 1rypU00 U:4-247 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhh....eeeee...eeeeeeeee..............eee...eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.........eeeeeeeee..eeeeeee.....eee..eeee.hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh....eeeeeeeee.......eee...hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
               PROSITE (17) ------------------PROTEASOME_ALPHA_2  PDB: U:22-239 UniProt: 23-240                                                                                                                                                                         -------- PROSITE (17)
              Transcript 13 Exon 13.1  PDB: U:4-247 UniProt: 1-288 [INCOMPLETE]                                                                                                                                                                                                  Transcript 13
                 1ryp U   4 GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEIN 247
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243    


Chain V from PDB  Type:PROTEIN  Length:205
 aligned with PSB1_YEAST | P38624 from UniProtKB/Swiss-Prot  Length:215

    Alignment length:205
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     
           PSB1_YEAST    11 LKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 215
               SCOP domains d1rypv_ V: Proteasome beta subunit (catalytic)                                                                                                                                                                SCOP domains
               CATH domains 1rypV00 V:-9-196 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeee...eeeeee...eee..eeee.....eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh......eeeeeeeee...eeeeeee.....eeee.eeee.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eeeeeee.hhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) --------PROTEASOME_BETA_2  PDB: V:-1-178 UniProt: 19-197                                                                                                                                   ------------------ PROSITE (12)
               PROSITE (13) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) ------------PROTEASOME_BETA_1  PDB: V:4-51 UniProt: 23-70   ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
           Transcript 8 (1) Exon 8.1    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 8 (1)
           Transcript 8 (2) -----------Exon 8.2  PDB: V:3-196 UniProt: 22-215                                                                                                                                                             Transcript 8 (2)
                 1ryp V  -9 LKKGEVSLGASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 196
                                    |1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191     
                                   -1|                                                                                                                                                                                                   
                                     1                                                                                                                                                                                                   


Chain W from PDB  Type:PROTEIN  Length:222
 aligned with PSB2_YEAST | P25043 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:222
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249  
           PSB2_YEAST    30 TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD 251
               SCOP domains d1rypw_ W: Proteasome beta subunit (catalytic)                                                                                                                                                                                 SCOP domains
               CATH domains 1rypW00 W:1-222 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..eeeeee...eee..eeee.....eeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh......eeeeeeeee..eeeeeee.....eee..eeee.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh........eeeeee.....eee................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) ---PROTEASOME_BETA_1  PDB: W:4-51 UniProt: 33-80   --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
              Transcript 12 Exon 12.1  PDB: W:1-222 UniProt: 1-261 [INCOMPLETE]                                                                                                                                                                            Transcript 12
                 1ryp W   1 TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD 222
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220  


Chain X from PDB  Type:PROTEIN  Length:204
 aligned with PSB3_YEAST | P25451 from UniProtKB/Swiss-Prot  Length:205

    Alignment length:204
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201    
           PSB3_YEAST     2 SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD 205
               SCOP domains d1rypx_ X: Proteasome beta subunit (catalytic)                                                                                                                                                               SCOP domains
               CATH domains 1rypX00 X:-8-196 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                  CATH domains
           Pfam domains (1) -----Proteasome-1rypX01 X:-3-181                                                                                                                                                             --------------- Pfam domains (1)
           Pfam domains (2) -----Proteasome-1rypX02 X:-3-181                                                                                                                                                             --------------- Pfam domains (2)
         Sec.struct. author ..hhh....eeeeee...eeeeeee..eee..eeee.....eeee..eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh......eeeeeeee......eeeee............eeeee..hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee...eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (7)
                PROSITE (8) -------PROTEASOME_BETA_2  PDB: X:-1-181 UniProt: 9-190                                                                                                                                       --------------- PROSITE (8)
                PROSITE (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (9)
               PROSITE (10) -----------PROTEASOME_BETA_1  PDB: X:4-50 UniProt: 13-59  -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               Transcript 3 Exon 3.1  PDB: X:-8-196 UniProt: 1-205 [INCOMPLETE]                                                                                                                                                          Transcript 3
                 1ryp X  -8 SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD 196
                                   ||2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192    
                                  -1|                                                                                                                                                                                                   
                                    1                                                                                                                                                                                                   


Chain Y from PDB  Type:PROTEIN  Length:198
 aligned with PSB4_YEAST | P22141 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:198
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190        
           PSB4_YEAST     1 MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ 198
               SCOP domains d1rypy_ Y: Proteasome beta subunit (catalytic)                                                                                                                                                         SCOP domains
               CATH domains 1rypY00 Y:-1-197 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee...eeeeeee..eee..eeee.....eeeee..eeeeeee...hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh......eeeeeeeee....eeeeeeee...eeee..eee...hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......eeeeeee..eeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) PROTEASOME_BETA_2  PDB: Y:-1-183 UniProt: 1-184                                                                                                                                         -------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ----PROTEASOME_BETA_1  PDB: Y:4-51 UniProt: 5-52    -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
               Transcript 2 Exon 2.1  PDB: Y:-1-197 UniProt: 1-198                                                                                                                                                                 Transcript 2
                 1ryp Y  -1 MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ 197
                            ||       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189        
                           -1|                                                                                                                                                                                                    
                             1                                                                                                                                                                                                    


Chain Z from PDB  Type:PROTEIN  Length:212
 aligned with PSB5_YEAST | P30656 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:212
                                    85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285  
           PSB5_YEAST    76 TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG 287
               SCOP domains d1rypz_ Z: Proteasome beta subunit (catalytic)                                                                                                                                                                       SCOP domains
               CATH domains 1rypZ00 Z:1-212 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                           CATH domains
           Pfam domains (1) Proteasome-1rypZ01 Z:1-180                                                                                                                                                          -------------------------------- Pfam domains (1)
           Pfam domains (2) Proteasome-1rypZ02 Z:1-180                                                                                                                                                          -------------------------------- Pfam domains (2)
         Sec.struct. author ..eeeeee..eeeeee...eee..eeee.....eee....eeee....hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh........eeeeeeee...eeeeeeee....eeee.eeee...hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh......eeeeeeee..eeee..eeehhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---PROTEASOME_BETA_1  PDB: Z:4-51 UniProt: 79-126  ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
              Transcript 14 Exon 14.1  PDB: Z:1-212 UniProt: 1-287 [INCOMPLETE]                                                                                                                                                                  Transcript 14
                 1ryp Z   1 TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKRVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG 212
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 28)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 28)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Architecture: 4-Layer Sandwich (459)
(-)
Topology: Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1 (128)
(-)
Homologous Superfamily: Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1 (124)
(-)
Baker's yeast (Saccharomyces cerevisiae) (14)
1a1ryp1001:-9-213
1b1rypM00M:-9-213
1c1rypF00F:2-234
1d1rypT00T:2-234
1e1rypL00L:1-212
1f1rypZ00Z:1-212
1g1rypD00D:3-243
1h1rypR00R:3-243
1i1rypA00A:10-252
1j1rypO00O:10-252
1k1rypC00C:2-245
1l1rypQ00Q:2-245
1m1rypG00G:4-247
1n1rypU00U:4-247
1o1rypH00H:-9-196
1p1rypV00V:-9-196
1q1rypI00I:1-222
1r1rypW00W:1-222
1s1rypJ00J:-8-196
1t1rypX00X:-8-196
1u1rypB00B:1-250
1v1rypP00P:1-250
1w1rypK00K:-1-197
1x1rypY00Y:-1-197
1y1rypE00E:9-250
1z1rypS00S:9-250
1aa1ryp2002:-8-225
1ab1rypN00N:-8-225

(-) Pfam Domains  (2, 12)

Asymmetric/Biological Unit
(-)
Clan: NTN (93)
(-)
Clan: no clan defined [family: Proteasome_A_N] (20)

(-) Gene Ontology  (26, 243)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1,M   (PSB6_YEAST | P23724)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain 2,N   (PSB7_YEAST | P30657)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain A,O   (PSA1_YEAST | P21243)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain B,P   (PSA2_YEAST | P23639)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain C,Q   (PSA3_YEAST | P23638)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0080129    proteasome core complex assembly    The aggregation, arrangement and bonding together of a mature, active 20S proteasome core particle complex that does not contain any regulatory particles.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain D,R   (PSA4_YEAST | P40303)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain E,S   (PSA5_YEAST | P32379)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain F,T   (PSA6_YEAST | P40302)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain G,U   (PSA7_YEAST | P21242)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003729    mRNA binding    Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain H,V   (PSB1_YEAST | P38624)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain I,W   (PSB2_YEAST | P25043)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain J,X   (PSB3_YEAST | P25451)
molecular function
    GO:0061133    endopeptidase activator activity    Increases the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010950    positive regulation of endopeptidase activity    Any process that increases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain K,Y   (PSB4_YEAST | P22141)
molecular function
    GO:0061133    endopeptidase activator activity    Increases the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010950    positive regulation of endopeptidase activity    Any process that increases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain L,Z   (PSB5_YEAST | P30656)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0080129    proteasome core complex assembly    The aggregation, arrangement and bonding together of a mature, active 20S proteasome core particle complex that does not contain any regulatory particles.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ryp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ryp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PSA1_YEAST | P21243
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA2_YEAST | P23639
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA3_YEAST | P23638
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA4_YEAST | P40303
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA5_YEAST | P32379
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA6_YEAST | P40302
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA7_YEAST | P21242
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB1_YEAST | P38624
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB2_YEAST | P25043
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB3_YEAST | P25451
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB4_YEAST | P22141
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB5_YEAST | P30656
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB6_YEAST | P23724
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB7_YEAST | P30657
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.99.46
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PSA1_YEAST | P21243
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA2_YEAST | P23639
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA3_YEAST | P23638
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA4_YEAST | P40303
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA5_YEAST | P32379
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA6_YEAST | P40302
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA7_YEAST | P21242
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB1_YEAST | P38624
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB2_YEAST | P25043
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB3_YEAST | P25451
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB4_YEAST | P22141
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB5_YEAST | P30656
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB6_YEAST | P23724
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB7_YEAST | P30657
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PSA1_YEAST | P21243: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA2_YEAST | P23639: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA3_YEAST | P23638: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA4_YEAST | P40303: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA5_YEAST | P32379: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2z5c 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA6_YEAST | P40302: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA7_YEAST | P21242: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB1_YEAST | P38624: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB2_YEAST | P25043: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB3_YEAST | P25451: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB4_YEAST | P22141: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB5_YEAST | P30656: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB6_YEAST | P23724: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB7_YEAST | P30657: 1fnt 1g0u 1g65 1jd2 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1RYP)