Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HIGH-RESOLUTION SOLUTION STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI-DIMENSIONAL NMR
 
Authors :  G. M. Clore, J. G. Omichinski, A. M. Gronenborn
Date :  13 Jun 94  (Deposition) - 31 Mar 95  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C,D  (35x)
Keywords :  Anti-Oncogene Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. M. Clore, J. G. Omichinski, K. Sakaguchi, N. Zambrano, H. Sakamoto, E. Appella, A. M. Gronenborn
High-Resolution Structure Of The Oligomerization Domain Of P53 By Multidimensional Nmr.
Science V. 265 386 1994
PubMed-ID: 8023159
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TUMOR SUPPRESSOR P53 (OLIGOMERIZATION DOMAIN)
    ChainsA, B, C, D
    EngineeredYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  
NMR Structure (35x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1OLH)

(-) Sites  (0, 0)

(no "Site" information available for 1OLH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OLH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1OLH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (71, 284)

NMR Structure (71, 284)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_045504K319EP53_HUMANUnclassified  ---A/B/C/DK319E
02UniProtVAR_045505K319NP53_HUMANUnclassified  ---A/B/C/DK319N
03UniProtVAR_045506K319RP53_HUMANUnclassified  ---A/B/C/DK319R
04UniProtVAR_045507K320NP53_HUMANUnclassified  ---A/B/C/DK320N
05UniProtVAR_045508K321EP53_HUMANUnclassified  ---A/B/C/DK321E
06UniProtVAR_045509K321RP53_HUMANUnclassified  ---A/B/C/DK321R
07UniProtVAR_045510P322LP53_HUMANUnclassified  ---A/B/C/DP322L
08UniProtVAR_045511P322RP53_HUMANUnclassified  ---A/B/C/DP322R
09UniProtVAR_045874L323GP53_HUMANUnclassified  ---A/B/C/DL323G
10UniProtVAR_045512L323MP53_HUMANUnclassified  ---A/B/C/DL323M
11UniProtVAR_045513L323PP53_HUMANUnclassified  ---A/B/C/DL323P
12UniProtVAR_045514L323RP53_HUMANUnclassified  ---A/B/C/DL323R
13UniProtVAR_047211L323VP53_HUMANUnclassified  ---A/B/C/DL323V
14UniProtVAR_045515D324EP53_HUMANUnclassified  ---A/B/C/DD324E
15UniProtVAR_045875D324SP53_HUMANUnclassified  ---A/B/C/DD324S
16UniProtVAR_045516D324YP53_HUMANUnclassified  ---A/B/C/DD324Y
17UniProtVAR_045517G325AP53_HUMANUnclassified  ---A/B/C/DG325A
18UniProtVAR_045518G325EP53_HUMANUnclassified  ---A/B/C/DG325E
19UniProtVAR_006039G325VP53_HUMANDisease (LFS)28934271A/B/C/DG325V
20UniProtVAR_045519E326GP53_HUMANUnclassified  ---A/B/C/DE326G
21UniProtVAR_045520Y327HP53_HUMANUnclassified  ---A/B/C/DY327H
22UniProtVAR_045521Y327SP53_HUMANUnclassified  ---A/B/C/DY327S
23UniProtVAR_045522F328LP53_HUMANUnclassified  ---A/B/C/DF328L
24UniProtVAR_045523F328SP53_HUMANUnclassified  ---A/B/C/DF328S
25UniProtVAR_045524F328VP53_HUMANUnclassified  ---A/B/C/DF328V
26UniProtVAR_045525T329IP53_HUMANUnclassified  ---A/B/C/DT329I
27UniProtVAR_045526T329SP53_HUMANUnclassified  ---A/B/C/DT329S
28UniProtVAR_045527L330HP53_HUMANUnclassified  ---A/B/C/DL330H
29UniProtVAR_047212L330PP53_HUMANUnclassified  ---A/B/C/DL330P
30UniProtVAR_045528L330RP53_HUMANUnclassified  ---A/B/C/DL330R
31UniProtVAR_045529Q331HP53_HUMANUnclassified11575996A/B/C/DQ331H
32UniProtVAR_045530Q331PP53_HUMANUnclassified  ---A/B/C/DQ331P
33UniProtVAR_045531Q331RP53_HUMANUnclassified  ---A/B/C/DQ331R
34UniProtVAR_045532I332VP53_HUMANUnclassified  ---A/B/C/DI332V
35UniProtVAR_006040G334VP53_HUMANUnclassified  ---A/B/C/DG334V
36UniProtVAR_045533G334WP53_HUMANUnclassified  ---A/B/C/DG334W
37UniProtVAR_045534R335GP53_HUMANUnclassified  ---A/B/C/DR335G
38UniProtVAR_045535R335HP53_HUMANUnclassified771939956A/B/C/DR335H
39UniProtVAR_045536R335LP53_HUMANUnclassified  ---A/B/C/DR335L
40UniProtVAR_006041R337CP53_HUMANDisease (LFS)587782529A/B/C/DR337C
41UniProtVAR_035016R337HP53_HUMANDisease (LFS)121912664A/B/C/DR337H
42UniProtVAR_045537R337LP53_HUMANUnclassified121912664A/B/C/DR337L
43UniProtVAR_045538R337PP53_HUMANUnclassified121912664A/B/C/DR337P
44UniProtVAR_045539F338IP53_HUMANUnclassified  ---A/B/C/DF338I
45UniProtVAR_045540F338LP53_HUMANUnclassified150293825A/B/C/DF338L
46UniProtVAR_022316E339KP53_HUMANUnclassified17882252A/B/C/DE339K
47UniProtVAR_045541E339QP53_HUMANUnclassified17882252A/B/C/DE339Q
48UniProtVAR_045542F341CP53_HUMANUnclassified  ---A/B/C/DF341C
49UniProtVAR_045543R342LP53_HUMANUnclassified  ---A/B/C/DR342L
50UniProtVAR_045544R342PP53_HUMANUnclassified375338359A/B/C/DR342P
51UniProtVAR_047213R342QP53_HUMANUnclassified375338359A/B/C/DR342Q
52UniProtVAR_045545E343GP53_HUMANUnclassified  ---A/B/C/DE343G
53UniProtVAR_045546L344PP53_HUMANDisease (LFS)121912662A/B/C/DL344P
54UniProtVAR_045547L344RP53_HUMANUnclassified  ---A/B/C/DL344R
55UniProtVAR_045548E346AP53_HUMANUnclassified  ---A/B/C/DE346A
56UniProtVAR_045549A347GP53_HUMANUnclassified  ---A/B/C/DA347G
57UniProtVAR_045550A347TP53_HUMANUnclassified  ---A/B/C/DA347T
58UniProtVAR_045551L348FP53_HUMANUnclassified  ---A/B/C/DL348F
59UniProtVAR_045552L348SP53_HUMANUnclassified  ---A/B/C/DL348S
60UniProtVAR_045553E349DP53_HUMANUnclassified  ---A/B/C/DE349D
61UniProtVAR_045554D352HP53_HUMANUnclassified  ---A/B/C/DD352H
62UniProtVAR_045555A353TP53_HUMANUnclassified  ---A/B/C/DA353T
63UniProtVAR_045556Q354EP53_HUMANUnclassified  ---A/B/C/DQ354E
64UniProtVAR_045557Q354KP53_HUMANUnclassified755394212A/B/C/DQ354K
65UniProtVAR_047214Q354RP53_HUMANUnclassified752142489A/B/C/DQ354R
66UniProtVAR_045558G356AP53_HUMANUnclassified  ---A/B/C/DG356A
67UniProtVAR_045559G356WP53_HUMANUnclassified  ---A/B/C/DG356W
68UniProtVAR_045560E358DP53_HUMANUnclassified  ---A/B/C/DE358D
69UniProtVAR_045561E358KP53_HUMANUnclassified587782237A/B/C/DE358K
70UniProtVAR_045562G360AP53_HUMANPolymorphism35993958A/B/C/DG360A
71UniProtVAR_045563G360VP53_HUMANUnclassified35993958A/B/C/DG360V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1OLH)

(-) Exons   (2, 8)

NMR Structure (2, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002693051aENSE00001146308chr17:7590856-7590695162P53_HUMAN-00--
1.3aENST000002693053aENSE00002194362chr17:7579940-7579839102P53_HUMAN1-25250--
1.3dENST000002693053dENSE00001710434chr17:7579721-757970022P53_HUMAN25-3280--
1.4bENST000002693054bENSE00001718735chr17:7579590-7579312279P53_HUMAN33-125930--
1.5dENST000002693055dENSE00001255919chr17:7578554-7578371184P53_HUMAN126-187620--
1.6aENST000002693056aENSE00001255912chr17:7578289-7578177113P53_HUMAN187-224380--
1.7bENST000002693057bENSE00001665758chr17:7577608-7577499110P53_HUMAN225-261370--
1.8ENST000002693058ENSE00001789298chr17:7577155-7577019137P53_HUMAN261-307470--
1.9ENST000002693059ENSE00002149110chr17:7576926-757685374P53_HUMAN307-331254A:319-331
B:319-331
C:319-331
D:319-331
13
13
13
13
1.11ENST0000026930511ENSE00001728015chr17:7574033-7573927107P53_HUMAN332-367364A:332-360
B:332-360
C:332-360
D:332-360
29
29
29
29
1.12dENST0000026930512dENSE00001757276chr17:7573008-75717201289P53_HUMAN367-393270--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:42
 aligned with P53_HUMAN | P04637 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:42
                                   328       338       348       358  
            P53_HUMAN   319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
               SCOP domains d1olha_ A: p53 tetramerization domain      SCOP domains
               CATH domains 1olhA00 A:319-360 p53, subunit A           CATH domains
               Pfam domains ------------------------------------------ Pfam domains
         Sec.struct. author ...........eeeehhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
             SAPs(SNPs) (1) ENELGEAGHLIHHV-VG-CIK-CLGP-AGFD--HTE-A-D-A SAPs(SNPs) (1)
             SAPs(SNPs) (2) N-RRMSE-SSSPP--WH-HLQ--P-R--TS-----K-W-K-V SAPs(SNPs) (2)
             SAPs(SNPs) (3) R---PYV--V-RR---L-L----Q-----------R------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----R-------------P----------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ----V------------------------------------- SAPs(SNPs) (5)
                    PROSITE ------------------------------------------ PROSITE
               Transcript 1 Exon 1.9     Exon 1.11  PDB: A:332-360     Transcript 1
                 1olh A 319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
                                   328       338       348       358  

Chain B from PDB  Type:PROTEIN  Length:42
 aligned with P53_HUMAN | P04637 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:42
                                   328       338       348       358  
            P53_HUMAN   319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
               SCOP domains d1olhb_ B: p53 tetramerization domain      SCOP domains
               CATH domains 1olhB00 B:319-360 p53, subunit A           CATH domains
               Pfam domains ------------------------------------------ Pfam domains
         Sec.struct. author ........eeeeeeehhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
             SAPs(SNPs) (1) ENELGEAGHLIHHV-VG-CIK-CLGP-AGFD--HTE-A-D-A SAPs(SNPs) (1)
             SAPs(SNPs) (2) N-RRMSE-SSSPP--WH-HLQ--P-R--TS-----K-W-K-V SAPs(SNPs) (2)
             SAPs(SNPs) (3) R---PYV--V-RR---L-L----Q-----------R------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----R-------------P----------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ----V------------------------------------- SAPs(SNPs) (5)
                    PROSITE ------------------------------------------ PROSITE
               Transcript 1 Exon 1.9     Exon 1.11  PDB: B:332-360     Transcript 1
                 1olh B 319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
                                   328       338       348       358  

Chain C from PDB  Type:PROTEIN  Length:42
 aligned with P53_HUMAN | P04637 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:42
                                   328       338       348       358  
            P53_HUMAN   319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
               SCOP domains d1olhc_ C: p53 tetramerization domain      SCOP domains
               CATH domains 1olhC00 C:319-360 p53, subunit A           CATH domains
               Pfam domains ------------------------------------------ Pfam domains
         Sec.struct. author ........eeee...hhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) ENELGEAGHLIHHV-VG-CIK-CLGP-AGFD--HTE-A-D-A SAPs(SNPs) (1)
             SAPs(SNPs) (2) N-RRMSE-SSSPP--WH-HLQ--P-R--TS-----K-W-K-V SAPs(SNPs) (2)
             SAPs(SNPs) (3) R---PYV--V-RR---L-L----Q-----------R------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----R-------------P----------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ----V------------------------------------- SAPs(SNPs) (5)
                    PROSITE ------------------------------------------ PROSITE
               Transcript 1 Exon 1.9     Exon 1.11  PDB: C:332-360     Transcript 1
                 1olh C 319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
                                   328       338       348       358  

Chain D from PDB  Type:PROTEIN  Length:42
 aligned with P53_HUMAN | P04637 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:42
                                   328       338       348       358  
            P53_HUMAN   319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
               SCOP domains d1olhd_ D: p53 tetramerization domain      SCOP domains
               CATH domains 1olhD00 D:319-360 p53, subunit A           CATH domains
           Pfam domains (1) P53_tetramer-1olhD01 D:319-359           - Pfam domains (1)
           Pfam domains (2) P53_tetramer-1olhD02 D:319-359           - Pfam domains (2)
           Pfam domains (3) P53_tetramer-1olhD03 D:319-359           - Pfam domains (3)
           Pfam domains (4) P53_tetramer-1olhD04 D:319-359           - Pfam domains (4)
         Sec.struct. author ........eeeeeeehhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
             SAPs(SNPs) (1) ENELGEAGHLIHHV-VG-CIK-CLGP-AGFD--HTE-A-D-A SAPs(SNPs) (1)
             SAPs(SNPs) (2) N-RRMSE-SSSPP--WH-HLQ--P-R--TS-----K-W-K-V SAPs(SNPs) (2)
             SAPs(SNPs) (3) R---PYV--V-RR---L-L----Q-----------R------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----R-------------P----------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ----V------------------------------------- SAPs(SNPs) (5)
                    PROSITE ------------------------------------------ PROSITE
               Transcript 1 Exon 1.9     Exon 1.11  PDB: D:332-360     Transcript 1
                 1olh D 319 KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360
                                   328       338       348       358  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

NMR Structure

(-) CATH Domains  (1, 4)

NMR Structure

(-) Pfam Domains  (1, 4)

NMR Structure

(-) Gene Ontology  (122, 122)

NMR Structure(hide GO term definitions)
Chain A,B,C,D   (P53_HUMAN | P04637)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000981    RNA polymerase II transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0001085    RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
    GO:0051087    chaperone binding    Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
    GO:0001046    core promoter sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is part of a core promoter region composed of the transcription start site and binding sites for the basal transcription machinery. The transcribed region might be described as a gene, cistron, or operon.
    GO:0003684    damaged DNA binding    Interacting selectively and non-covalently with damaged DNA.
    GO:0003690    double-stranded DNA binding    Interacting selectively and non-covalently with double-stranded DNA.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0035035    histone acetyltransferase binding    Interacting selectively and non-covalently with the enzyme histone acetyltransferase.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0002039    p53 binding    Interacting selectively and non-covalently with one of the p53 family of proteins.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0047485    protein N-terminus binding    Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0051721    protein phosphatase 2A binding    Interacting selectively and non-covalently with the enzyme protein phosphatase 2A.
    GO:0019903    protein phosphatase binding    Interacting selectively and non-covalently with any protein phosphatase.
    GO:0043621    protein self-association    Interacting selectively and non-covalently with a domain within the same polypeptide.
    GO:0030971    receptor tyrosine kinase binding    Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0001228    transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in the transcription regulatory region for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0030330    DNA damage response, signal transduction by p53 class mediator    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage.
    GO:0006977    DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
    GO:0006978    DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, resulting in the induction of the transcription of p21 (also known as WAF1, CIP1 and SDI1) or any equivalent protein, in response to the detection of DNA damage.
    GO:0000733    DNA strand renaturation    The identification and annealing of complementary base pairs in single-strand DNA.
    GO:0006983    ER overload response    The series of molecular signals generated by the accumulation of normal or misfolded proteins in the endoplasmic reticulum and leading to activation of transcription by NF-kappaB.
    GO:0007265    Ras protein signal transduction    A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0006284    base-excision repair    In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
    GO:0007569    cell aging    An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0034613    cellular protein localization    Any process in which a protein is transported to, and/or maintained in, a specific location at the level of a cell. Localization at the cellular level encompasses movement within the cell, from within the cell to the cell surface, or from one location to another at the surface of a cell.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0034644    cellular response to UV    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0042149    cellular response to glucose starvation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of glucose.
    GO:0071456    cellular response to hypoxia    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0071479    cellular response to ionizing radiation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
    GO:0031497    chromatin assembly    The assembly of DNA, histone proteins, other associated proteins, and sometimes RNA, into chromatin structure, beginning with the formation of the basic unit, the nucleosome, followed by organization of the nucleosomes into higher order structures, ultimately giving rise to a complex organization of specific domains within the nucleus.
    GO:0048512    circadian behavior    The specific behavior of an organism that recurs with a regularity of approximately 24 hours.
    GO:0008340    determination of adult lifespan    The control of viability and duration in the adult phase of the life-cycle.
    GO:0043153    entrainment of circadian clock by photoperiod    The synchronization of a circadian rhythm to photoperiod, the intermittent cycle of light (day) and dark (night).
    GO:0097193    intrinsic apoptotic signaling pathway    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway starts with reception of an intracellular signal (e.g. DNA damage, endoplasmic reticulum stress, oxidative stress etc.), and ends when the execution phase of apoptosis is triggered. The intrinsic apoptotic signaling pathway is crucially regulated by permeabilization of the mitochondrial outer membrane (MOMP).
    GO:0072332    intrinsic apoptotic signaling pathway by p53 class mediator    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
    GO:0042771    intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
    GO:0031571    mitotic G1 DNA damage checkpoint    A mitotic cell cycle checkpoint that detects and negatively regulates progression through the G1/S transition of the cell cycle in response to DNA damage.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0048147    negative regulation of fibroblast proliferation    Any process that stops, prevents, or reduces the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
    GO:0051097    negative regulation of helicase activity    Any process that stops or reduces the activity of a helicase.
    GO:0051974    negative regulation of telomerase activity    Any process that stops or reduces the activity of the enzyme telomerase, which catalyzes of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006289    nucleotide-excision repair    A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
    GO:0097252    oligodendrocyte apoptotic process    Any apoptotic process in an oligodendrocyte. Oligodendrocytes belong to a class of large neuroglial (macroglial) cells in the central nervous system, where they form the insulating myelin sheath of axons.
    GO:0090403    oxidative stress-induced premature senescence    A cellular senescence process associated with the dismantling of a cell as a response to oxidative stress, e.g. high levels of reactive oxygen species, such as superoxide anions, hydrogen peroxide, and hydroxyl radicals.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0071158    positive regulation of cell cycle arrest    Any process that increases the rate, frequency, or extent of cell cycle arrest, the process in which the cell cycle is halted during one of the normal phases.
    GO:1900119    positive regulation of execution phase of apoptosis    Any process that activates or increases the frequency, rate or extent of execution phase of apoptosis.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0031065    positive regulation of histone deacetylation    Any process that activates or increases the frequency, rate or extent of the removal of acetyl groups from histones.
    GO:2001244    positive regulation of intrinsic apoptotic signaling pathway    Any process that activates or increases the frequency, rate or extent of intrinsic apoptotic signaling pathway.
    GO:0043525    positive regulation of neuron apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0046827    positive regulation of protein export from nucleus    Any process that activates or increases the frequency, rate or extent of directed movement of proteins from the nucleus into the cytoplasm.
    GO:1900740    positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway    Any process that activates or increases the frequency, rate or extent of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway.
    GO:0032461    positive regulation of protein oligomerization    Any process that activates or increases the frequency, rate or extent of protein oligomerization.
    GO:2000379    positive regulation of reactive oxygen species metabolic process    Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
    GO:0090200    positive regulation of release of cytochrome c from mitochondria    Any process that increases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
    GO:0070245    positive regulation of thymocyte apoptotic process    Any process that activates or increases the frequency, rate or extent of thymocyte death by apoptotic process.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:1990440    positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of an endoplasmic reticulum stress.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0012501    programmed cell death    A process which begins when a cell receives an internal or external signal and activates a series of biochemical events (signaling pathway). The process ends with the death of the cell.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006461    protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex.
    GO:0008104    protein localization    Any process in which a protein is transported to, or maintained in, a specific location.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:1902749    regulation of cell cycle G2/M phase transition    Any process that modulates the frequency, rate or extent of cell cycle G2/M phase transition.
    GO:0046902    regulation of mitochondrial membrane permeability    Any process that modulates the frequency, rate or extent of the passage or uptake of molecules by the mitochondrial membrane.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0090399    replicative senescence    A cell aging process associated with the dismantling of a cell as a response to telomere shortening and/or cellular aging.
    GO:0010165    response to X-ray    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
    GO:0010332    response to gamma radiation    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
    GO:0048511    rhythmic process    Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0016605    PML body    A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0016604    nuclear body    Extra-nucleolar nuclear domains usually visualized by confocal microscopy and fluorescent antibodies to specific proteins.
    GO:0000790    nuclear chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
    GO:0016363    nuclear matrix    The dense fibrillar network lying on the inner side of the nuclear membrane.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0005657    replication fork    The Y-shaped region of a replicating DNA molecule, resulting from the separation of the DNA strands and in which the synthesis of new strands takes place. Also includes associated protein complexes.
    GO:0005669    transcription factor TFIID complex    A complex composed of TATA binding protein (TBP) and TBP associated factors (TAFs); the total mass is typically about 800 kDa. Most of the TAFs are conserved across species. In TATA-containing promoters for RNA polymerase II (Pol II), TFIID is believed to recognize at least two distinct elements, the TATA element and a downstream promoter element. TFIID is also involved in recognition of TATA-less Pol II promoters. Binding of TFIID to DNA is necessary but not sufficient for transcription initiation from most RNA polymerase II promoters.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1olh)
 
  Sites
(no "Sites" information available for 1olh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1olh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1olh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P53_HUMAN | P04637
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  151623
    Disease InformationOMIM
 
Access by GenAge ID
  0006
    Age Related InformationGenAge
  0192
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  P53_HUMAN | P04637
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        P53_HUMAN | P046371a1u 1aie 1c26 1dt7 1gzh 1h26 1hs5 1jsp 1kzy 1ma3 1olg 1pes 1pet 1sae 1saf 1sak 1sal 1tsr 1tup 1uol 1xqh 1yc5 1ycq 1ycr 1ycs 2ac0 2ady 2ahi 2ata 2b3g 2bim 2bin 2bio 2bip 2biq 2f1x 2fej 2foj 2foo 2gs0 2h1l 2h2d 2h2f 2h4f 2h4h 2h4j 2h59 2j0z 2j10 2j11 2j1w 2j1x 2j1y 2j1z 2j20 2j21 2k8f 2l14 2ly4 2mej 2mwo 2mwp 2mwy 2mzd 2ocj 2pcx 2ruk 2vuk 2wgx 2x0u 2x0v 2x0w 2xwr 2ybg 2ydr 2z5s 2z5t 3d05 3d06 3d07 3d08 3d09 3d0a 3dab 3dac 3igk 3igl 3kmd 3kz8 3lw1 3oq5 3pdh 3q01 3q05 3q06 3sak 3tg5 3ts8 3zme 4agl 4agm 4agn 4ago 4agp 4agq 4buz 4bv2 4fz3 4hfz 4hje 4ibq 4ibs 4ibt 4ibu 4ibv 4ibw 4iby 4ibz 4ijt 4kvp 4lo9 4loe 4lof 4mzi 4mzr 4qo1 4rp6 4rp7 4x34 4xr8 4zzj 5a7b 5ab9 5aba 5aoi 5aoj 5aok 5aol 5aom 5bua 5ecg 5g4m 5g4n 5g4o 5hou 5hp0 5hpd 5lap 5lgy 5un8

(-) Related Entries Specified in the PDB File

1olg