Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HIGH-RESOLUTION SOLUTION STRUCTURE OF A SWEET PROTEIN SINGLE-CHAIN MONELLIN (SCM) DETERMINED BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND DYNAMICAL SIMULATED ANNEALING CALCULATIONS, 21 STRUCTURES
 
Authors :  S. -Y. Lee, J. -H. Lee, H. -J. Chang, J. -M. Jo, J. -W. Jung, W. Lee
Date :  06 Aug 98  (Deposition) - 08 Jun 99  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (21x)
Keywords :  Sweet Protein, Sweet Receptor Binding, Alpha/Beta Motif (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Y. Lee, J. H. Lee, H. J. Chang, J. M. Cho, J. W. Jung, W. Lee
Solution Structure Of A Sweet Protein Single-Chain Monellin Determined By Nuclear Magnetic Resonance And Dynamical Simulated Annealing Calculations.
Biochemistry V. 38 2340 1999
PubMed-ID: 10029527  |  Reference-DOI: 10.1021/BI9822731
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MONELLIN
    Chains: A
    Engineered: YES
    Expression System: SACCHAROMYCES CEREVISIAE
    Expression System Common: BAKER'S YEAST
    Expression System Taxid: 4932
    Organism Common: SERENDIPITY BERRY
    Organism Scientific: DIOSCOREOPHYLLUM CUMMINSII
    Organism Taxid: 3457
    Synonym: SCM

 Structural Features

(-) Chains, Units

  
NMR Structure (21x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MNL)

(-) Sites  (0, 0)

(no "Site" information available for 1MNL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MNL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MNL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MNL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1MNL)

(-) Exons   (0, 0)

(no "Exon" information available for 1MNL)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:91
 aligned with MONA_DIOCU | P02881 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:91
                                                             1                2                                        
                                     -         -         -   |     -         -|       11        21        31        41 
            MONA_DIOCU    - ---------------------------------F----------------REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPV 42
               SCOP domains d1mnla_ A: Monellin, B & A chains together                                                  SCOP domains
               CATH domains 1mnlA00 A:1-91  [code=3.10.450.10, no name defined]                                         CATH domains
               Pfam domains Monellin-1mnlA02 A:1-40                 ----------Monellin-1mnlA01 A:51-91                  Pfam domains
         Sec.struct. author .eeee....hhhhhhhhhhhhhhhhh..............eeeee..........eeeee.........eeeee.........eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                  1mnl A  1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPV 91
                                    10        20        30        40        50        60        70        80        90 


Chain A from PDB  Type:PROTEIN  Length:91
 aligned with MONB_DIOCU | P02882 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:91
                                                                            50                                         
                                    10        20        30        40        50         -         -         -         - 
            MONB_DIOCU    1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN-----------------------------------------  -
               SCOP domains d1mnla_ A: Monellin, B & A chains together                                                  SCOP domains
               CATH domains 1mnlA00 A:1-91  [code=3.10.450.10, no name defined]                                         CATH domains
               Pfam domains Monellin-1mnlA02 A:1-40                 ----------Monellin-1mnlA01 A:51-91                  Pfam domains
         Sec.struct. author .eeee....hhhhhhhhhhhhhhhhh..............eeeee..........eeeee.........eeeee.........eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                  1mnl A  1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPV 91
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: no clan defined [family: Monellin] (7)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 1MNL)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mnl)
 
  Sites
(no "Sites" information available for 1mnl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1mnl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mnl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MONA_DIOCU | P02881
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MONB_DIOCU | P02882
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MONA_DIOCU | P02881
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MONB_DIOCU | P02882
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MONA_DIOCU | P02881: 1fa3 1fuw 1iv7 1iv9 1krl 1m9g 2gpk 2o9u 3mon 3pxm 3pyj 3q2p 4mon 5lc6 5lc7
        MONB_DIOCU | P02882: 1fa3 1fuw 1iv7 1iv9 1krl 1m9g 1mol 2o9u 3mon 3pxm 3pyj 3q2p 4mon 5lc6 5lc7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MNL)