Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF UNACTIVATED APO INSULIN-LIKE GROWTH FACTOR-1 RECEPTOR KINASE DOMAIN
 
Authors :  S. Munshi, L. Kuo
Date :  22 Jul 02  (Deposition) - 07 Jan 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Munshi, M. Kornienko, D. L. Hall, J. C. Reid, L. Waxman, S. M. Stirdivant, P. L. Darke, L. C. Kuo
Crystal Structure Of The Apo, Unactivated Insulin-Like Growth Factor-1 Receptor Kinase. Implication For Inhibitor Specificity.
J. Biol. Chem. V. 277 38797 2002
PubMed-ID: 12138114  |  Reference-DOI: 10.1074/JBC.M205580200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INSULIN-LIKE GROWTH FACTOR I RECEPTOR
    ChainsA, B
    EC Number2.7.1.112
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF9
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentKINASE DOMAIN (RESIDUES 974-1286)
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCD221 ANTIGEN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1M7N)

(-) Sites  (0, 0)

(no "Site" information available for 1M7N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1M7N)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gln A:1070 -Pro A:1071
2Gln B:1070 -Pro B:1071

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---A/BR1253S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---AR1253S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---BR1253S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
  2A:1002-1030
B:1002-1030
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
  2A:1128-1140
B:1128-1140
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
  2A:1156-1164
B:1156-1164
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
  1A:1002-1030
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
  1A:1128-1140
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
  1A:1156-1164
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
  1-
B:1002-1030
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
  1-
B:1128-1140
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
  1-
B:1156-1164

(-) Exons   (7, 14)

Asymmetric Unit (7, 14)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002680351aENSE00001618814chr15:99192200-99192904705IGF1R_HUMAN1-32320--
1.2ENST000002680352ENSE00000943091chr15:99250791-99251336546IGF1R_HUMAN32-2141830--
1.3ENST000002680353ENSE00001320137chr15:99434554-99434866313IGF1R_HUMAN214-3181050--
1.4ENST000002680354ENSE00001129109chr15:99439986-99440134149IGF1R_HUMAN318-368510--
1.5ENST000002680355ENSE00001301974chr15:99442706-99442850145IGF1R_HUMAN368-416490--
1.6ENST000002680356ENSE00001129094chr15:99451914-99452128215IGF1R_HUMAN416-488730--
1.7ENST000002680357ENSE00001129087chr15:99454544-99454670127IGF1R_HUMAN488-530430--
1.8ENST000002680358ENSE00001129080chr15:99456273-99456511239IGF1R_HUMAN530-610810--
1.9ENST000002680359ENSE00001129073chr15:99459193-99459360168IGF1R_HUMAN610-666570--
1.10ENST0000026803510ENSE00001129062chr15:99459901-99460105205IGF1R_HUMAN666-734690--
1.11ENST0000026803511ENSE00001129055chr15:99465377-99465660284IGF1R_HUMAN734-829960--
1.12ENST0000026803512ENSE00001129044chr15:99467105-99467241137IGF1R_HUMAN829-874460--
1.13ENST0000026803513ENSE00001311160chr15:99467754-99467913160IGF1R_HUMAN875-928540--
1.14aENST0000026803514aENSE00001318374chr15:99472787-99472889103IGF1R_HUMAN928-962350--
1.15ENST0000026803515ENSE00001297944chr15:99473464-9947353471IGF1R_HUMAN962-986252A:979-983
B:979-983
5
5
1.16ENST0000026803516ENSE00001129013chr15:99478053-99478282230IGF1R_HUMAN986-1062772A:983-1059
B:983-1059
77
77
1.17ENST0000026803517ENSE00001129006chr15:99478545-99478655111IGF1R_HUMAN1063-1099372A:1060-1093
B:1060-1093
34
34
1.18ENST0000026803518ENSE00001319679chr15:99482430-99482589160IGF1R_HUMAN1100-1153542A:1100-1150
B:1100-1150
51
51
1.19ENST0000026803519ENSE00001597369chr15:99486152-99486281130IGF1R_HUMAN1153-1196442A:1150-1193
B:1150-1193
44
44
1.20ENST0000026803520ENSE00001128979chr15:99491803-99491937135IGF1R_HUMAN1196-1241462A:1193-1238
B:1193-1238
46
46
1.21bENST0000026803521bENSE00001316091chr15:99500290-995077597470IGF1R_HUMAN1241-13671272A:1238-1283
B:1238-1283
46
46

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:299
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:305
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281     
         IGF1R_HUMAN    982 SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d1m7na_ A: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains ------1m7nA01 A:985-1078 Phosphorylase Kinase; domain 1                                             1m7nA02 A:1079-      1280 Transferase(Phosphotransferase) domain 1                                                                                                                                        --- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhh.eeeeeeeee....eeeeeee..........eeeeee.....hhhhhhhhhhhhhhh..........eeeee......eeeee.....hhhhhhhh...------.....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee......hhhhhhhhee.hhh.eehhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhh....hhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15 ----------------------------------------------------------------------------Exon 1.17  PDB: A:1060-1093          Exon 1.18  PDB: A:1100-1150 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: A:1193-1238 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.16  PDB: A:983-1059 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: A:1150-1193                 --------------------------------------------Exon 1.21b  PDB: A:1238-1283 [INCOMPLETE]      Transcript 1 (2)
                1m7n A  979 SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP------VLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1283
                                   988       998      1008      1018      1028      1038      1048      1058      1068      1078      1088    |    - |    1108      1118      1128      1138      1148      1158      1168      1178      1188      1198      1208      1218      1228      1238      1248      1258      1268      1278     
                                                                                                                                           1093   1100                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:299
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:305
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271      1281     
         IGF1R_HUMAN    982 SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d1m7nb_ B: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains ------1m7nB01 B:985-1078 Phosphorylase Kinase; domain 1                                             1m7nB02 B:1079-      1280 Transferase(Phosphotransferase) domain 1                                                                                                                                        --- CATH domains
           Pfam domains (1) -----------------Pkinase_Tyr-1m7nB01 B:996-1263                                                                                                                                                                                                                                              -------------------- Pfam domains (1)
           Pfam domains (2) -----------------Pkinase_Tyr-1m7nB02 B:996-1263                                                                                                                                                                                                                                              -------------------- Pfam domains (2)
         Sec.struct. author .............hhh.eeeeeeeee....eeeeeeee.......eeeeeeee.....hhhhhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhh...------.....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee......hhhhhhhhee.....eehhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhh.......hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15 ----------------------------------------------------------------------------Exon 1.17  PDB: B:1060-1093          Exon 1.18  PDB: B:1100-1150 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: B:1193-1238 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.16  PDB: B:983-1059 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: B:1150-1193                 --------------------------------------------Exon 1.21b  PDB: B:1238-1283 [INCOMPLETE]      Transcript 1 (2)
                1m7n B  979 SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP------VLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1283
                                   988       998      1008      1018      1028      1038      1048      1058      1068      1078      1088    |    - |    1108      1118      1128      1138      1148      1158      1168      1178      1188      1198      1208      1218      1228      1238      1248      1258      1268      1278     
                                                                                                                                           1093   1100                                                                                                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: PKinase (934)

(-) Gene Ontology  (41, 41)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (IGF1R_HUMAN | P08069)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0043559    insulin binding    Interacting selectively and non-covalently with insulin, a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0005158    insulin receptor binding    Interacting selectively and non-covalently with the insulin receptor.
    GO:0043560    insulin receptor substrate binding    Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
    GO:0031994    insulin-like growth factor I binding    Interacting selectively and non-covalently with insulin-like growth factor I.
    GO:0005520    insulin-like growth factor binding    Interacting selectively and non-covalently with an insulin-like growth factor, any member of a group of polypeptides that are structurally homologous to insulin and share many of its biological activities, but are immunologically distinct from it.
    GO:0005010    insulin-like growth factor-activated receptor activity    Combining with insulin-like growth factor and transmitting the signal across the plasma membrane to initiate a change in cell activity.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0043548    phosphatidylinositol 3-kinase binding    Interacting selectively and non-covalently with a phosphatidylinositol 3-kinase, any enzyme that catalyzes the addition of a phosphate group to an inositol lipid at the 3' position of the inositol ring.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0051389    inactivation of MAPKK activity    Any process that terminates the activity of the active enzyme MAP kinase kinase (MAPKK).
    GO:0008286    insulin receptor signaling pathway    The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
    GO:0048009    insulin-like growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0038083    peptidyl-tyrosine autophosphorylation    The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
    GO:0014065    phosphatidylinositol 3-kinase signaling    A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0045740    positive regulation of DNA replication    Any process that activates or increases the frequency, rate or extent of DNA replication.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
    GO:0046328    regulation of JNK cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the JNK cascade.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0035867    alphav-beta3 integrin-IGF-1-IGF1R complex    A protein complex that consists of an alphav-beta3 integrin complex bound to insulin-like growth factor-1 (IGF-1) and type I insulin-like growth factor receptor (IGF1R). IGF1R is a heterotetramer that consists of two alpha-subunits and two beta-subunits.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1m7n)
 
  Sites
(no "Sites" information available for 1m7n)
 
  Cis Peptide Bonds
    Gln A:1070 - Pro A:1071   [ RasMol ]  
    Gln B:1070 - Pro B:1071   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1m7n
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IGF1R_HUMAN | P08069
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.112
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  270450
    Disease InformationOMIM
 
Access by GenAge ID
  0015
    Age Related InformationGenAge
  0110
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IGF1R_HUMAN | P08069
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IGF1R_HUMAN | P080691igr 1jqh 1k3a 1p4o 2oj9 2zm3 3d94 3f5p 3i81 3lvp 3lw0 3nw5 3nw6 3nw7 3o23 3qqu 4d2r 4xss 5fxq 5fxr 5fxs 5hzn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1M7N)