3LW0 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   IGF-1RK IN COMPLEX WITH LIGAND MSC1609119A-1

Authors :   U. Graedler, T. Heinrich, H. Boettcher, A. Blaukat, A. Shutes, B. Askew

Date :   23 Feb 10 (Deposition) - 29 Sep 10 (Release) - 29 Sep 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.79

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Protein Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Heinrich, U. Graedler, H. Boettcher, A. Blaukat, A. Shutes
Allosteric Igf-1R Inhibitors
Acs Med. Chem. Lett. V. 1 199 2010
PubMed: search | Reference-DOI: 10.1021/ML100044H

Molecule 1 - INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
	Chains	:	A, B, C, D
	EC Number	:	2.7.10.1
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Taxid	:	7108
	Fragment	:	PROTEIN KINASE, UNP RESIDUES 983-1286
	Gene	:	IGF1R
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IGF-1 RECEPTOR KINASE, INSULIN-LIKE GROWTH FACTOR I RECEPTOR, IGF-I RECEPTOR, INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR ALPHA CHAIN, INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR BETA CHAIN

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 10)

No.	Name	Count	Type	Full Name
1	CCX	8	Ligand/Ion	3-CYANO-N-{1-[4-(5-CYANO-1H-INDOL-3-YL)BUTYL]PIPERIDIN-4-YL}-1H-INDOLE-7-CARBOXAMIDE
2	GOL	2	Ligand/Ion	GLYCEROL

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	CCX	2	Ligand/Ion	3-CYANO-N-{1-[4-(5-CYANO-1H-INDOL-3-YL)BUTYL]PIPERIDIN-4-YL}-1H-INDOLE-7-CARBOXAMIDE
2	GOL	-1	Ligand/Ion	GLYCEROL

Biological Unit 2 (2, 3)

No.	Name	Count	Type	Full Name
1	CCX	2	Ligand/Ion	3-CYANO-N-{1-[4-(5-CYANO-1H-INDOL-3-YL)BUTYL]PIPERIDIN-4-YL}-1H-INDOLE-7-CARBOXAMIDE
2	GOL	1	Ligand/Ion	GLYCEROL

Biological Unit 3 (2, 3)

No.	Name	Count	Type	Full Name
1	CCX	2	Ligand/Ion	3-CYANO-N-{1-[4-(5-CYANO-1H-INDOL-3-YL)BUTYL]PIPERIDIN-4-YL}-1H-INDOLE-7-CARBOXAMIDE
2	GOL	1	Ligand/Ion	GLYCEROL

Biological Unit 4 (1, 2)

No.	Name	Count	Type	Full Name
1	CCX	2	Ligand/Ion	3-CYANO-N-{1-[4-(5-CYANO-1H-INDOL-3-YL)BUTYL]PIPERIDIN-4-YL}-1H-INDOLE-7-CARBOXAMIDE
2	GOL	-1	Ligand/Ion	GLYCEROL

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HOH A:355 , HOH A:450 , ALA A:1051 , MET A:1054 , VAL A:1063 , HIS A:1133 , ILE A:1151 , GLY A:1152	BINDING SITE FOR RESIDUE CCX A 1
02	AC2	SOFTWARE	HOH A:289 , HOH A:352 , HOH A:361 , HOH A:787 , TYR A:1090 , GLN A:1114 , MET A:1115 , GLU A:1118 , ASP A:1146 , PHE A:1147 , THR A:1148 , GLU A:1271 , PRO A:1272 , GLY A:1273 , HOH D:471 , GLY D:1273 , PHE D:1274 , VAL D:1277 , CCX D:1287	BINDING SITE FOR RESIDUE CCX A 1287
03	AC3	SOFTWARE	HOH B:267 , HOH B:446 , ALA B:1051 , MET B:1054 , VAL B:1063 , HIS B:1133 , ILE B:1151 , GLY B:1152	BINDING SITE FOR RESIDUE CCX B 2
04	AC4	SOFTWARE	HOH B:292 , HOH B:635 , HOH B:772 , TYR B:1090 , MET B:1115 , GLU B:1118 , ASP B:1146 , PHE B:1147 , THR B:1148 , GLU B:1271 , PRO B:1272 , GLY B:1273 , HOH C:444 , GLY C:1273 , PHE C:1274 , VAL C:1277 , CCX C:1287	BINDING SITE FOR RESIDUE CCX B 1287
05	AC5	SOFTWARE	HOH B:441 , SER B:1110 , GLN B:1114 , GLU B:1271	BINDING SITE FOR RESIDUE GOL B 1
06	AC6	SOFTWARE	HOH C:219 , HOH C:403 , ALA C:1051 , MET C:1054 , VAL C:1063 , VAL C:1077 , HIS C:1133 , ILE C:1151 , GLY C:1152	BINDING SITE FOR RESIDUE CCX C 3
07	AC7	SOFTWARE	HOH B:510 , GLY B:1273 , PHE B:1274 , VAL B:1277 , CCX B:1287 , HOH C:290 , HOH C:611 , HOH C:800 , TYR C:1090 , MET C:1115 , GLU C:1118 , ASP C:1146 , PHE C:1147 , THR C:1148 , GLU C:1271 , PRO C:1272 , GLY C:1273	BINDING SITE FOR RESIDUE CCX C 1287
08	AC8	SOFTWARE	PHE C:1224 , GLU C:1227 , GLY C:1229 , ASN C:1236	BINDING SITE FOR RESIDUE GOL C 2
09	AC9	SOFTWARE	HOH D:253 , HOH D:485 , ALA D:1051 , MET D:1054 , VAL D:1063 , HIS D:1133 , ILE D:1151 , GLY D:1152	BINDING SITE FOR RESIDUE CCX D 4
10	BC1	SOFTWARE	HOH A:492 , GLY A:1273 , PHE A:1274 , VAL A:1277 , CCX A:1287 , HOH D:304 , HOH D:939 , TYR D:1090 , GLN D:1114 , MET D:1115 , GLU D:1118 , ASP D:1146 , PHE D:1147 , THR D:1148 , GLU D:1271 , PRO D:1272 , GLY D:1273	BINDING SITE FOR RESIDUE CCX D 1287

(no "SS Bond" information available for 3LW0)

Asymmetric Unit

No.	Residues
1	Gln A:1073	-	Pro A:1074
2	Gln B:1073	-	Pro B:1074
3	Gln C:1073	-	Pro C:1074
4	Gln D:1073	-	Pro D:1074

Asymmetric Unit (1, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_076249	R	1256	S	IGF1R_HUMAN	Disease (IGF1RES)	---	A/B/C/D	R	1256	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_076249	R	1256	S	IGF1R_HUMAN	Disease (IGF1RES)	---	A	R	1256	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_076249	R	1256	S	IGF1R_HUMAN	Disease (IGF1RES)	---	B	R	1256	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_076249	R	1256	S	IGF1R_HUMAN	Disease (IGF1RES)	---	C	R	1256	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_076249	R	1256	S	IGF1R_HUMAN	Disease (IGF1RES)	---	D	R	1256	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	IGF1R_HUMAN	1005-1033	4	A:1005-1033 B:1005-1033 C:1005-1033 D:1005-1033
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	IGF1R_HUMAN	1131-1143	4	A:1131-1143 B:1131-1143 C:1131-1143 D:1131-1143
3	RECEPTOR_TYR_KIN_II	PS00239	Receptor tyrosine kinase class II signature.	IGF1R_HUMAN	1159-1167	4	A:1159-1167 B:1159-1167 C:1159-1167 D:1159-1167

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	IGF1R_HUMAN	1005-1033	1	A:1005-1033 - - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	IGF1R_HUMAN	1131-1143	1	A:1131-1143 - - -
3	RECEPTOR_TYR_KIN_II	PS00239	Receptor tyrosine kinase class II signature.	IGF1R_HUMAN	1159-1167	1	A:1159-1167 - - -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	IGF1R_HUMAN	1005-1033	1	- B:1005-1033 - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	IGF1R_HUMAN	1131-1143	1	- B:1131-1143 - -
3	RECEPTOR_TYR_KIN_II	PS00239	Receptor tyrosine kinase class II signature.	IGF1R_HUMAN	1159-1167	1	- B:1159-1167 - -

Biological Unit 3 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	IGF1R_HUMAN	1005-1033	1	- - C:1005-1033 -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	IGF1R_HUMAN	1131-1143	1	- - C:1131-1143 -
3	RECEPTOR_TYR_KIN_II	PS00239	Receptor tyrosine kinase class II signature.	IGF1R_HUMAN	1159-1167	1	- - C:1159-1167 -

Biological Unit 4 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	IGF1R_HUMAN	1005-1033	1	- - - D:1005-1033
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	IGF1R_HUMAN	1131-1143	1	- - - D:1131-1143
3	RECEPTOR_TYR_KIN_II	PS00239	Receptor tyrosine kinase class II signature.	IGF1R_HUMAN	1159-1167	1	- - - D:1159-1167

Asymmetric Unit (7, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000268035	1a	ENSE00001618814	chr15:99192200-99192904	705	IGF1R_HUMAN	1-32	32	0	-	-
1.2	ENST00000268035	2	ENSE00000943091	chr15:99250791-99251336	546	IGF1R_HUMAN	32-214	183	0	-	-
1.3	ENST00000268035	3	ENSE00001320137	chr15:99434554-99434866	313	IGF1R_HUMAN	214-318	105	0	-	-
1.4	ENST00000268035	4	ENSE00001129109	chr15:99439986-99440134	149	IGF1R_HUMAN	318-368	51	0	-	-
1.5	ENST00000268035	5	ENSE00001301974	chr15:99442706-99442850	145	IGF1R_HUMAN	368-416	49	0	-	-
1.6	ENST00000268035	6	ENSE00001129094	chr15:99451914-99452128	215	IGF1R_HUMAN	416-488	73	0	-	-
1.7	ENST00000268035	7	ENSE00001129087	chr15:99454544-99454670	127	IGF1R_HUMAN	488-530	43	0	-	-
1.8	ENST00000268035	8	ENSE00001129080	chr15:99456273-99456511	239	IGF1R_HUMAN	530-610	81	0	-	-
1.9	ENST00000268035	9	ENSE00001129073	chr15:99459193-99459360	168	IGF1R_HUMAN	610-666	57	0	-	-
1.10	ENST00000268035	10	ENSE00001129062	chr15:99459901-99460105	205	IGF1R_HUMAN	666-734	69	0	-	-
1.11	ENST00000268035	11	ENSE00001129055	chr15:99465377-99465660	284	IGF1R_HUMAN	734-829	96	0	-	-
1.12	ENST00000268035	12	ENSE00001129044	chr15:99467105-99467241	137	IGF1R_HUMAN	829-874	46	0	-	-
1.13	ENST00000268035	13	ENSE00001311160	chr15:99467754-99467913	160	IGF1R_HUMAN	875-928	54	0	-	-
1.14a	ENST00000268035	14a	ENSE00001318374	chr15:99472787-99472889	103	IGF1R_HUMAN	928-962	35	0	-	-
1.15	ENST00000268035	15	ENSE00001297944	chr15:99473464-99473534	71	IGF1R_HUMAN	962-986	25	4	A:983-986 B:983-986 C:983-986 D:983-986	4 4 4 4
1.16	ENST00000268035	16	ENSE00001129013	chr15:99478053-99478282	230	IGF1R_HUMAN	986-1062	77	4	A:986-1062 B:986-1062 C:986-1062 D:986-1062	77 77 77 77
1.17	ENST00000268035	17	ENSE00001129006	chr15:99478545-99478655	111	IGF1R_HUMAN	1063-1099	37	4	A:1063-1096 B:1063-1096 C:1063-1096 D:1063-1096	34 34 34 34
1.18	ENST00000268035	18	ENSE00001319679	chr15:99482430-99482589	160	IGF1R_HUMAN	1100-1153	54	4	A:1106-1153 B:1106-1153 C:1106-1153 D:1106-1153	48 48 48 48
1.19	ENST00000268035	19	ENSE00001597369	chr15:99486152-99486281	130	IGF1R_HUMAN	1153-1196	44	4	A:1153-1196 (gaps) B:1153-1196 (gaps) C:1153-1196 (gaps) D:1153-1196 (gaps)	44 44 44 44
1.20	ENST00000268035	20	ENSE00001128979	chr15:99491803-99491937	135	IGF1R_HUMAN	1196-1241	46	4	A:1196-1241 B:1196-1241 C:1196-1241 D:1196-1241	46 46 46 46
1.21b	ENST00000268035	21b	ENSE00001316091	chr15:99500290-99507759	7470	IGF1R_HUMAN	1241-1367	127	4	A:1241-1286 B:1241-1286 C:1241-1286 D:1241-1286	46 46 46 46

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:292
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:304
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
         IGF1R_HUMAN    983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3lw0a_ A: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhh.eeeeeeeee....eeeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh..---------..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.........hhhhh...---...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE ----------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15----------------------------------------------------------------------------Exon 1.17  PDB: A:1063-1096          Exon 1.18  PDB: A:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: A:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.16  PDB: A:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: A:1153-1196 (gaps)          --------------------------------------------Exon 1.21b  PDB: A:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3lw0 A  983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRK---GLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092   |     -   |  1112      1122      1132      1142      1152      1162     |1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
                                                                                                                                          1096      1106                                                          1168   |                                                                                                                  
                                                                                                                                                                                                                      1172

Chain B from PDB  Type:PROTEIN  Length:292
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:304
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
         IGF1R_HUMAN    983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3lw0b_ B: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhh.eeeeeeeee....eeeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh..---------..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.........hhhhh...---...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE ----------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15----------------------------------------------------------------------------Exon 1.17  PDB: B:1063-1096          Exon 1.18  PDB: B:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: B:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.16  PDB: B:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: B:1153-1196 (gaps)          --------------------------------------------Exon 1.21b  PDB: B:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3lw0 B  983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRK---GLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092   |     -   |  1112      1122      1132      1142      1152      1162     |1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
                                                                                                                                          1096      1106                                                          1168   |                                                                                                                  
                                                                                                                                                                                                                      1172

Chain C from PDB  Type:PROTEIN  Length:292
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:304
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
         IGF1R_HUMAN    983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3lw0c_ C: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhh.eeeeeeeee....eeeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhhh.........eeeee......eeeee....eehhhhhhhh..---------..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.........hhhhh...---...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE ----------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15----------------------------------------------------------------------------Exon 1.17  PDB: C:1063-1096          Exon 1.18  PDB: C:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: C:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.16  PDB: C:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: C:1153-1196 (gaps)          --------------------------------------------Exon 1.21b  PDB: C:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3lw0 C  983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRK---GLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092   |     -   |  1112      1122      1132      1142      1152      1162     |1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
                                                                                                                                          1096      1106                                                          1168   |                                                                                                                  
                                                                                                                                                                                                                      1172

Chain D from PDB  Type:PROTEIN  Length:292
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:304
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
         IGF1R_HUMAN    983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3lw0d_ D: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------Pkinase_Tyr-3lw0D01 D:999-1266                                                                                                                                                                                                                                              -------------------- Pfam domains (1)
           Pfam domains (2) ----------------Pkinase_Tyr-3lw0D02 D:999-1266                                                                                                                                                                                                                                              -------------------- Pfam domains (2)
           Pfam domains (3) ----------------Pkinase_Tyr-3lw0D03 D:999-1266                                                                                                                                                                                                                                              -------------------- Pfam domains (3)
           Pfam domains (4) ----------------Pkinase_Tyr-3lw0D04 D:999-1266                                                                                                                                                                                                                                              -------------------- Pfam domains (4)
         Sec.struct. author ............hhh.eeeeeeeee....eeeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh..---------..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.........hhhhh...---...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE ----------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15----------------------------------------------------------------------------Exon 1.17  PDB: D:1063-1096          Exon 1.18  PDB: D:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: D:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.16  PDB: D:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: D:1153-1196 (gaps)          --------------------------------------------Exon 1.21b  PDB: D:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3lw0 D  983 AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRK---GLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092   |     -   |  1112      1122      1132      1142      1152      1162     |1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282    
                                                                                                                                          1096      1106                                                          1168   |                                                                                                                  
                                                                                                                                                                                                                      1172

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Protein kinase-like (PK-like) (2589)

Superfamily: Protein kinase-like (PK-like) (2589)

Family: Protein kinases, catalytic subunit (1977)

Protein domain: Insulin-like growth factor 1 receptor (16)

Human (Homo sapiens) [TaxId: 9606] (16)

1a	d3lw0a_	A:
1b	d3lw0b_	B:
1c	d3lw0c_	C:
1d	d3lw0d_	D:

(no "CATH Domain" information available for 3LW0)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PKinase (934)

Family: Pkinase_Tyr (229)

Homo sapiens (Human) (202)

1a	Pkinase_Tyr-3lw0D01	D:999-1266
1b	Pkinase_Tyr-3lw0D02	D:999-1266
1c	Pkinase_Tyr-3lw0D03	D:999-1266
1d	Pkinase_Tyr-3lw0D04	D:999-1266

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (IGF1R_HUMAN | P08069)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0043559	insulin binding	Interacting selectively and non-covalently with insulin, a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0005158	insulin receptor binding	Interacting selectively and non-covalently with the insulin receptor.
	GO:0043560	insulin receptor substrate binding	Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
	GO:0031994	insulin-like growth factor I binding	Interacting selectively and non-covalently with insulin-like growth factor I.
	GO:0005520	insulin-like growth factor binding	Interacting selectively and non-covalently with an insulin-like growth factor, any member of a group of polypeptides that are structurally homologous to insulin and share many of its biological activities, but are immunologically distinct from it.
	GO:0005010	insulin-like growth factor-activated receptor activity	Combining with insulin-like growth factor and transmitting the signal across the plasma membrane to initiate a change in cell activity.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0043548	phosphatidylinositol 3-kinase binding	Interacting selectively and non-covalently with a phosphatidylinositol 3-kinase, any enzyme that catalyzes the addition of a phosphate group to an inositol lipid at the 3' position of the inositol ring.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004714	transmembrane receptor protein tyrosine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0051389	inactivation of MAPKK activity	Any process that terminates the activity of the active enzyme MAP kinase kinase (MAPKK).
	GO:0008286	insulin receptor signaling pathway	The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
	GO:0048009	insulin-like growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0038083	peptidyl-tyrosine autophosphorylation	The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
	GO:0014065	phosphatidylinositol 3-kinase signaling	A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0045740	positive regulation of DNA replication	Any process that activates or increases the frequency, rate or extent of DNA replication.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0051262	protein tetramerization	The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
	GO:0046328	regulation of JNK cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the JNK cascade.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	A protein complex that consists of an alphav-beta3 integrin complex bound to insulin-like growth factor-1 (IGF-1) and type I insulin-like growth factor receptor (IGF1R). IGF1R is a heterotetramer that consists of two alpha-subunits and two beta-subunits.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CCX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gln A:1073 - Pro A:1074	[ RasMol ]
		Gln B:1073 - Pro B:1074	[ RasMol ]
		Gln C:1073 - Pro C:1074	[ RasMol ]
		Gln D:1073 - Pro D:1074	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3lw0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IGF1R_HUMAN \| P08069
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	270450
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IGF1R_HUMAN \| P08069
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 3LW0)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 4)

PROSITE Motifs (3, 12)

Exons (7, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (41, 41)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File