Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A METHANOBACTERIAL SM-LIKE ARCHAEAL PROTEIN (SMAP1) BOUND TO URIDINE-5'-MONOPHOSPHATE (UMP)
 
Authors :  C. Mura, A. Kozhukhovsky, D. Eisenberg
Date :  06 May 02  (Deposition) - 25 Mar 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N
Biol. Unit 1:  A,B,C,D,E,F,G  (1x)
Biol. Unit 2:  H,I,J,K,L,M,N  (1x)
Biol. Unit 3:  A,B,C,D,E,F,G,H,I,J,K,L,M,N  (1x)
Keywords :  Beta Barrel, Ob-Fold, Heptameric Toroid, Tetradecamer, Rna Binding Protein, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Mura, A. Kozhukhovsky, M. Gingery, M. Phillips, D. Eisenberg
The Oligomerization And Ligand-Binding Properties Of Sm-Like Archaeal Proteins (Smaps)
Protein Sci. V. 12 832 2003
PubMed-ID: 12649441  |  Reference-DOI: 10.1110/PS.0224703
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SMALL NUCLEAR RIBONUCLEOPROTEIN HOMOLOG (SM- LIKE)
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET-22B(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneMTH649
    Organism ScientificMETHANOTHERMOBACTER THERMAUTOTROPHICUS STR. DELTA H
    Organism Taxid187420
    Other DetailsFULL-LENGTH SMAP1 WITH ADDITIONAL 5-6 RESIDUES APPENDED TO THE C-TERMINUS (ARTEFACT OF CLONING VECTOR)
    StrainDELTA H
    SynonymSM-LIKE ARCHAEAL PROTEIN SMAP1

 Structural Features

(-) Chains, Units

  1234567891011121314
Asymmetric Unit ABCDEFGHIJKLMN
Biological Unit 1 (1x)ABCDEFG       
Biological Unit 2 (1x)       HIJKLMN
Biological Unit 3 (1x)ABCDEFGHIJKLMN

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 28)

Asymmetric Unit (3, 28)
No.NameCountTypeFull Name
1MPD14Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
2U6Ligand/IonURIDINE-5'-MONOPHOSPHATE
3URI8Ligand/IonURIDINE
Biological Unit 1 (2, 12)
No.NameCountTypeFull Name
1MPD7Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
2U-1Ligand/IonURIDINE-5'-MONOPHOSPHATE
3URI5Ligand/IonURIDINE
Biological Unit 2 (2, 10)
No.NameCountTypeFull Name
1MPD7Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
2U-1Ligand/IonURIDINE-5'-MONOPHOSPHATE
3URI3Ligand/IonURIDINE
Biological Unit 3 (2, 22)
No.NameCountTypeFull Name
1MPD14Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
2U-1Ligand/IonURIDINE-5'-MONOPHOSPHATE
3URI8Ligand/IonURIDINE

(-) Sites  (28, 28)

Asymmetric Unit (28, 28)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREU I:9002 , HIS J:46 , ASN J:48 , ARG J:72 , GLY J:73 , ASP J:74 , ARG K:72 , U K:9014BINDING SITE FOR RESIDUE URI J 9001
02AC2SOFTWAREHIS H:46 , MET H:47 , U H:9003 , HIS I:46 , ASN I:48 , ARG I:72 , ASP I:74 , HOH I:9012 , ARG J:72 , URI J:9001BINDING SITE FOR RESIDUE U I 9002
03AC3SOFTWAREHIS H:46 , ASN H:48 , ARG H:72 , GLY H:73 , ASP H:74 , ARG I:72 , U I:9002 , LEU N:15 , LEU N:45 , HIS N:46 , MET N:47 , U N:9013BINDING SITE FOR RESIDUE U H 9003
04AC4SOFTWAREMET L:47 , URI L:9005 , ASN M:48 , ARG M:72 , GLY M:73 , ASP M:74 , U N:9013BINDING SITE FOR RESIDUE URI M 9004
05AC5SOFTWAREMET K:47 , U K:9014 , HIS L:46 , ASN L:48 , ARG L:72 , GLY L:73 , ASP L:74 , HOH L:9010 , ARG M:72 , URI M:9004BINDING SITE FOR RESIDUE URI L 9005
06AC6SOFTWAREMET D:47 , U D:9008 , HIS E:46 , ASN E:48 , ARG E:72 , GLY E:73 , ASP E:74 , HOH E:9020 , ARG F:72 , URI F:9009BINDING SITE FOR RESIDUE URI E 9006
07AC7SOFTWARELEU A:45 , MET A:47 , U A:9010 , HIS B:46 , ASN B:48 , ARG B:72 , GLY B:73 , ASP B:74 , URI C:9011BINDING SITE FOR RESIDUE URI B 9007
08AC8SOFTWARELEU C:45 , MET C:47 , URI C:9011 , HIS D:46 , ASN D:48 , ARG D:72 , GLY D:73 , ASP D:74 , HOH D:9023 , ARG E:72 , URI E:9006BINDING SITE FOR RESIDUE U D 9008
09AC9SOFTWARELEU E:45 , MET E:47 , URI E:9006 , HIS F:46 , ASN F:48 , ARG F:72 , GLY F:73 , ASP F:74 , ARG G:72 , URI G:9012BINDING SITE FOR RESIDUE URI F 9009
10BC1SOFTWAREHIS A:46 , ASN A:48 , ARG A:72 , GLY A:73 , ASP A:74 , ARG B:72 , URI B:9007 , LEU G:15 , HOH G:9028BINDING SITE FOR RESIDUE U A 9010
11BC2SOFTWAREMET B:47 , URI B:9007 , ASN C:48 , ARG C:72 , GLY C:73 , ASP C:74 , HOH C:9034 , ARG D:72 , U D:9008BINDING SITE FOR RESIDUE URI C 9011
12BC3SOFTWARELEU F:45 , MET F:47 , URI F:9009 , HIS G:46 , ASN G:48 , ARG G:72 , GLY G:73 , ASP G:74 , HOH G:9035 , HOH G:9046BINDING SITE FOR RESIDUE URI G 9012
13BC4SOFTWAREARG H:72 , U H:9003 , HIS M:46 , MET M:47 , URI M:9004 , HIS N:46 , ASN N:48 , ARG N:72 , GLY N:73 , ASP N:74 , HOH N:9034BINDING SITE FOR RESIDUE U N 9013
14BC5SOFTWARELEU J:45 , HIS J:46 , MET J:47 , URI J:9001 , HIS K:46 , ASN K:48 , ARG K:72 , GLY K:73 , ASP K:74 , HOH K:9026 , ARG L:72 , URI L:9005BINDING SITE FOR RESIDUE U K 9014
15BC6SOFTWAREALA J:17 , LEU J:18 , SER J:21 , ILE J:79 , ARG J:81 , HOH J:9008 , HOH J:9009 , HOH J:9010 , THR K:68BINDING SITE FOR RESIDUE MPD J 7001
16BC7SOFTWAREALA K:17 , LEU K:18 , SER K:21 , ARG K:81BINDING SITE FOR RESIDUE MPD K 7002
17BC8SOFTWAREALA L:17 , LEU L:18 , SER L:21 , ILE L:79 , SER L:80 , ARG L:81 , THR M:68 , VAL M:69BINDING SITE FOR RESIDUE MPD L 7003
18BC9SOFTWAREALA D:17 , LEU D:18 , SER D:21 , ILE D:79 , ARG D:81 , HOH D:9018BINDING SITE FOR RESIDUE MPD D 7004
19CC1SOFTWAREALA A:17 , SER A:21 , ILE A:79 , ARG A:81 , HOH A:9032BINDING SITE FOR RESIDUE MPD A 7005
20CC2SOFTWAREALA C:17 , SER C:21 , ILE C:79 , ARG C:81 , HOH C:9016 , HOH C:9026 , THR D:68BINDING SITE FOR RESIDUE MPD C 7006
21CC3SOFTWARETHR A:68 , ALA G:17 , LEU G:18 , SER G:21BINDING SITE FOR RESIDUE MPD G 7007
22CC4SOFTWAREALA H:17 , LEU H:18 , SER H:21 , ARG H:81 , THR I:68BINDING SITE FOR RESIDUE MPD H 7008
23CC5SOFTWARETHR H:68 , ALA N:17 , LEU N:18 , SER N:21BINDING SITE FOR RESIDUE MPD N 7009
24CC6SOFTWAREALA M:17 , LEU M:18 , SER M:21 , ILE M:79 , ARG M:81 , THR N:68BINDING SITE FOR RESIDUE MPD M 7010
25CC7SOFTWAREALA B:17 , LEU B:18 , SER B:21 , SER B:80 , ARG B:81 , THR C:68BINDING SITE FOR RESIDUE MPD B 7011
26CC8SOFTWAREALA E:17 , SER E:21 , VAL F:50 , THR F:68BINDING SITE FOR RESIDUE MPD E 7012
27CC9SOFTWARESER F:21 , ILE F:79 , ARG F:81 , HOH F:9013 , VAL G:50BINDING SITE FOR RESIDUE MPD F 7013
28DC1SOFTWAREALA I:17 , LEU I:18 , SER I:21 , ILE I:79 , SER I:80 , ARG I:81 , THR J:68BINDING SITE FOR RESIDUE MPD I 7014

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1LOJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1LOJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1LOJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1LOJ)

(-) Exons   (0, 0)

(no "Exon" information available for 1LOJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:76
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:76
                                                                                                   81   
                                    18        28        38        48        58        68        78  |   
            RUXX_METTH    9 VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP---  -
               SCOP domains d1loja_ A: Archaeal homoheptameric Sm protein                                SCOP domains
               CATH domains 1lojA00 A:9-84  [code=2.30.30.100, no name defined]                          CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                  1loj A  9 VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKL 84
                                    18        28        38        48        58        68        78      

Chain B from PDB  Type:PROTEIN  Length:76
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:76
                                                                                                 81     
                                    20        30        40        50        60        70        80|     
            RUXX_METTH   11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP-----  -
               SCOP domains d1lojb_ B: Archaeal homoheptameric Sm protein                                SCOP domains
               CATH domains 1lojB00 B:11-86  [code=2.30.30.100, no name defined]                         CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                  1loj B 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA 86
                                    20        30        40        50        60        70        80      

Chain C from PDB  Type:PROTEIN  Length:77
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:77
                                                                                                 81      
                                    20        30        40        50        60        70        80|      
            RUXX_METTH   11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP------  -
               SCOP domains d1lojc_ C: Archaeal homoheptameric Sm protein                                 SCOP domains
               CATH domains 1lojC00 C:11-87  [code=2.30.30.100, no name defined]                          CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                  1loj C 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAAA 87
                                    20        30        40        50        60        70        80       

Chain D from PDB  Type:PROTEIN  Length:74
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:74
                                                                                                  81  
                                    19        29        39        49        59        69        79 |  
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP--  -
               SCOP domains d1lojd_ D: Archaeal homoheptameric Sm protein                              SCOP domains
               CATH domains 1lojD00 D:10-83  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeee....eeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1loj D 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83
                                    19        29        39        49        59        69        79    

Chain E from PDB  Type:PROTEIN  Length:75
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:75
                                                                                                  81   
                                    19        29        39        49        59        69        79 |   
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP---  -
               SCOP domains d1loje_ E: Archaeal homoheptameric Sm protein                               SCOP domains
               CATH domains 1lojE00 E:10-84  [code=2.30.30.100, no name defined]                        CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                  1loj E 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKL 84
                                    19        29        39        49        59        69        79     

Chain F from PDB  Type:PROTEIN  Length:75
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:75
                                                                                                  81   
                                    19        29        39        49        59        69        79 |   
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP---  -
               SCOP domains d1lojf_ F: Archaeal homoheptameric Sm protein                               SCOP domains
               CATH domains 1lojF00 F:10-84  [code=2.30.30.100, no name defined]                        CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                  1loj F 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKL 84
                                    19        29        39        49        59        69        79     

Chain G from PDB  Type:PROTEIN  Length:75
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:75
                                                                                                  81   
                                    19        29        39        49        59        69        79 |   
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP---  -
               SCOP domains d1lojg_ G: Archaeal homoheptameric Sm protein                               SCOP domains
               CATH domains 1lojG00 G:10-84  [code=2.30.30.100, no name defined]                        CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                  1loj G 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKL 84
                                    19        29        39        49        59        69        79     

Chain H from PDB  Type:PROTEIN  Length:76
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:76
                                                                                                  81    
                                    19        29        39        49        59        69        79 |    
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP----  -
               SCOP domains d1lojh_ H: Archaeal homoheptameric Sm protein                                SCOP domains
               CATH domains 1lojH00 H:10-85  [code=2.30.30.100, no name defined]                         CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee...eeeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                  1loj H 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLA 85
                                    19        29        39        49        59        69        79      

Chain I from PDB  Type:PROTEIN  Length:74
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:74
                                                                                                  81  
                                    19        29        39        49        59        69        79 |  
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP--  -
               SCOP domains d1loji_ I: Archaeal homoheptameric Sm protein                              SCOP domains
               CATH domains 1lojI00 I:10-83  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1loj I 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83
                                    19        29        39        49        59        69        79    

Chain J from PDB  Type:PROTEIN  Length:76
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:76
                                                                                                 81     
                                    20        30        40        50        60        70        80|     
            RUXX_METTH   11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP-----  -
               SCOP domains d1lojj_ J: Archaeal homoheptameric Sm protein                                SCOP domains
               CATH domains 1lojJ00 J:11-86  [code=2.30.30.100, no name defined]                         CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeeeee...eeeeeeeeee.....eeeeeeeeee.....eeeeeeee....eeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                  1loj J 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA 86
                                    20        30        40        50        60        70        80      

Chain K from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:72
                                    19        29        39        49        59        69        79  
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP 81
               SCOP domains d1lojk_ K: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1lojK00 K:10-81  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1loj K 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISR 81
                                    19        29        39        49        59        69        79  

Chain L from PDB  Type:PROTEIN  Length:74
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:74
                                                                                                  81  
                                    19        29        39        49        59        69        79 |  
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP--  -
               SCOP domains d1lojl_ L: Archaeal homoheptameric Sm protein                              SCOP domains
               CATH domains 1lojL00 L:10-83  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1loj L 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83
                                    19        29        39        49        59        69        79    

Chain M from PDB  Type:PROTEIN  Length:73
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:73
                                                                                                 81  
                                    20        30        40        50        60        70        80|  
            RUXX_METTH   11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP--  -
               SCOP domains d1lojm_ M: Archaeal homoheptameric Sm protein                             SCOP domains
               CATH domains 1lojM00 M:11-83  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeee....eeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                  1loj M 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83
                                    20        30        40        50        60        70        80   

Chain N from PDB  Type:PROTEIN  Length:74
 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:74
                                                                                                  81  
                                    19        29        39        49        59        69        79 |  
            RUXX_METTH   10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP--  -
               SCOP domains d1lojn_ N: Archaeal homoheptameric Sm protein                              SCOP domains
               CATH domains 1lojN00 N:10-83  [code=2.30.30.100, no name defined]                       CATH domains
           Pfam domains (1) ------LSM-1lojN01 N:16-80                                              --- Pfam domains (1)
           Pfam domains (2) ------LSM-1lojN02 N:16-80                                              --- Pfam domains (2)
           Pfam domains (3) ------LSM-1lojN03 N:16-80                                              --- Pfam domains (3)
           Pfam domains (4) ------LSM-1lojN04 N:16-80                                              --- Pfam domains (4)
           Pfam domains (5) ------LSM-1lojN05 N:16-80                                              --- Pfam domains (5)
           Pfam domains (6) ------LSM-1lojN06 N:16-80                                              --- Pfam domains (6)
           Pfam domains (7) ------LSM-1lojN07 N:16-80                                              --- Pfam domains (7)
           Pfam domains (8) ------LSM-1lojN08 N:16-80                                              --- Pfam domains (8)
           Pfam domains (9) ------LSM-1lojN09 N:16-80                                              --- Pfam domains (9)
          Pfam domains (10) ------LSM-1lojN10 N:16-80                                              --- Pfam domains (10)
          Pfam domains (11) ------LSM-1lojN11 N:16-80                                              --- Pfam domains (11)
          Pfam domains (12) ------LSM-1lojN12 N:16-80                                              --- Pfam domains (12)
          Pfam domains (13) ------LSM-1lojN13 N:16-80                                              --- Pfam domains (13)
          Pfam domains (14) ------LSM-1lojN14 N:16-80                                              --- Pfam domains (14)
         Sec.struct. author ...hhhhhhhhhh..eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1loj N 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83
                                    19        29        39        49        59        69        79    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 14)

Asymmetric Unit

(-) CATH Domains  (1, 14)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
1a1lojK00K:10-81
1b1lojM00M:11-83
1c1lojB00B:11-86
1d1lojH00H:10-85
1e1lojJ00J:11-86
1f1lojC00C:11-87
1g1lojD00D:10-83
1h1lojI00I:10-83
1i1lojL00L:10-83
1j1lojN00N:10-83
1k1lojE00E:10-84
1l1lojF00F:10-84
1m1lojG00G:10-84
1n1lojA00A:9-84

(-) Pfam Domains  (1, 14)

Asymmetric Unit
(-)
Clan: Sm-like (17)
(-)
Family: LSM (13)
1aLSM-1lojN01N:16-80
1bLSM-1lojN02N:16-80
1cLSM-1lojN03N:16-80
1dLSM-1lojN04N:16-80
1eLSM-1lojN05N:16-80
1fLSM-1lojN06N:16-80
1gLSM-1lojN07N:16-80
1hLSM-1lojN08N:16-80
1iLSM-1lojN09N:16-80
1jLSM-1lojN10N:16-80
1kLSM-1lojN11N:16-80
1lLSM-1lojN12N:16-80
1mLSM-1lojN13N:16-80
1nLSM-1lojN14N:16-80

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L,M,N   (RUXX_METTH | O26745)
biological process
    GO:0000398    mRNA splicing, via spliceosome    The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005732    small nucleolar ribonucleoprotein complex    A ribonucleoprotein complex that contains an RNA molecule of the small nucleolar RNA (snoRNA) family and associated proteins. Most are involved in a step of processing of rRNA: cleavage, 2'-O-methylation, or pseudouridylation. The majority, though not all, fall into one of two classes, box C/D type or box H/ACA type.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    U  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    URI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1loj)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1loj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RUXX_METTH | O26745
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RUXX_METTH | O26745
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RUXX_METTH | O267451i81 1jbm 1jri 1mgq

(-) Related Entries Specified in the PDB File

1i5l CRYSTAL STRUCTURE OF A HOMOLGOUS SM-LIKE ARCHAEL PROTEIN FROM ARCHAEOGLOBUS FULGIDUS (AFU SMAP1) WITH OLIGOURIDINE BOUND (U3).
1i81 CRYSTAL STRUCTURE OF THE SAME PROTEIN (MTH SMAP1) IN A P2(1) CRYSTAL FORM WITH A SINGLE HEPTAMER PER ASYMMETRIC UNIT.
1i8f CRYSTAL STRUCTURE OF A HOMOLGOUS SM-LIKE ARCHAEL PROTEIN FROM PYROBACULUM AEROPHILUM (PAE SMAP1) IN A C2 LATTICE WITH A SINGLE HEPTAMER PER ASYMMETRIC UNIT.
1jbm CRYSTAL STRUCTURE OF THE SAME PROTEIN (MTH SMAP1) IN A P1 CRYSTAL FORM WITH A SINGLE HEPTAMER PER CELL.
1jri CRYSTAL STRUCTURE OF THE SAME PROTEIN (MTH SMAP1) IN A P2(1)2(1)2(1) CRYSTAL FORM WITH TWO HEPTAMERS PER ASYMMETRIC UNIT (SIDE-SIDE PACKING OF HEPTAMERS).
1lnx CRYSTAL STRUCTURE OF A HOMOLGOUS SM-LIKE ARCHAEL PROTEIN FROM PYROBACULUM AEROPHILUM (PAE SMAP1) IN A C222(1) LATTICE WITH BOUND URIDINE.