|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1HC9) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1HC9) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:74 aligned with 3L21V_BUNMU | P60616 from UniProtKB/Swiss-Prot Length:95 Alignment length:74 31 41 51 61 71 81 91 3L21V_BUNMU 22 IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 95 SCOP domains d1hc9a_ A: Bungarotoxin SCOP domains CATH domains 1hc9A00 A:1-74 CD59 CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ------------------------------------------SNAKE_TOXIN ----------- PROSITE (2) Transcript -------------------------------------------------------------------------- Transcript 1hc9 A 1 IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 74 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:74 aligned with 3L21A_BUNMU | P60615 from UniProtKB/Swiss-Prot Length:95 Alignment length:74 31 41 51 61 71 81 91 3L21A_BUNMU 22 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 95 SCOP domains d1hc9b_ B: Bungarotoxin SCOP domains CATH domains 1hc9B00 B:1-74 CD59 CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------SNAKE_TOXIN ----------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 1hc9 B 1 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 74 10 20 30 40 50 60 70 Chain C from PDB Type:PROTEIN Length:13 SCOP domains ------------- SCOP domains CATH domains ------------- CATH domains Pfam domains ------------- Pfam domains SAPs(SNPs) ------------- SAPs(SNPs) PROSITE ------------- PROSITE Transcript ------------- Transcript 1hc9 C 1 WRYYESSLLPYPD 13 10 Chain D from PDB Type:PROTEIN Length:12 SCOP domains ------------ SCOP domains CATH domains ------------ CATH domains Pfam domains ------------ Pfam domains SAPs(SNPs) ------------ SAPs(SNPs) PROSITE ------------ PROSITE Transcript ------------ Transcript 1hc9 D 1 WRYYESSLLPYP 12 10
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1HC9) |
Asymmetric Unit(hide GO term definitions) Chain A (3L21V_BUNMU | P60616)
Chain B (3L21A_BUNMU | P60615)
|
|
|
|
|
|
|